Recombinant Mouse Leucine-rich repeat-containing protein 4C (Lrrc4c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Lrrc4c; Ngl1; Leucine-rich repeat-containing protein 4C; Netrin-G1 ligand; NGL-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-640
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Lrrc4c
Target Protein Sequence
QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARCNTPPNLKGRYIGEL DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIA VLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEP SQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMK TTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESH LPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Uniprot No.

Target Background

Function
May promote neurite outgrowth in developing thalamic neurons.
Gene References Into Functions
  1. Axonal NGL-1 transneuronally determines lamina-specific subdendritic segments. PMID: 17785411
  2. NGL-1 shows highest abundance in the striatum and cerebral cortex – the intermediate and final targets of thalamocortical axons. Membrane-bound NGL-1 stimulates, while soluble NGL-1 inhibits, the growth of embryonic thalamic axons. PMID: 4595443
Database Links
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure of recombinant mouse LRRC4C protein?

Recombinant mouse LRRC4C protein (Met1-Lys527) consists of 494 amino acids with a predicted molecular mass of 55.5 kDa. The protein is typically expressed with a polyhistidine tag at the C-terminus to facilitate purification and detection . The protein structure includes:

  • Protein length: Met1-Lys527

  • Predicted N-Terminal: Gln 45

  • Tag: His-tagged at C-terminus

  • Expression system: HEK293 cells

When working with recombinant LRRC4C, researchers should note that the protein is usually lyophilized from sterile PBS (pH 7.4) with protectants such as 5-8% trehalose, mannitol, and 0.01% Tween80 .

How does LRRC4C distribute in the mouse hippocampus?

LRRC4C shows a distinct laminar distribution in the hippocampus:

  • LRRC4C is mainly detected in the stratum lacunosum moleculare (SLM) layer of the hippocampus relative to the stratum radiatum (SR) layer

  • This distribution pattern is important for understanding the input-specific functions of LRRC4C

  • The differential expression between dorsal and ventral hippocampus has functional implications

  • Immunohistochemical studies reveal that deletion of Lrrc4c affects both SR and SLM layers, despite its enrichment in SLM

This distinctive distribution pattern suggests LRRC4C may play region-specific roles in hippocampal function and information processing.

What behavioral phenotypes are associated with Lrrc4c deletion in mice?

Lrrc4c−/− mice display multiple distinct behavioral phenotypes:

Behavioral DomainPhenotype in Lrrc4c−/− MiceTest/Measurement
Locomotor activityStrong hyperactivity in familiar environmentsLaboras cages, open-field test
Anxiety-like behaviorAnxiolytic-like behaviorElevated plus maze, light-dark box, marble burying
Spatial memoryImpairedMorris water maze
Working memorySuppressedT-maze
Object recognitionNormalNovel object recognition test
Depression-like behaviorLargely normalForced swim test, tail suspension test
Perceptual learningDelayed learningOrientation discrimination task

These mice show strong hyperactivity in familiar environments but moderate hyperactivity in novel environments . They spend significantly more time in open arms in the elevated plus maze test and more time in light chambers in the light-dark box test, indicating anxiolytic-like behavior . They also show impaired spatial and working memory but normal object recognition memory .

What methodological approaches are optimal for studying synaptic changes in Lrrc4c knockout models?

When investigating synaptic alterations in Lrrc4c knockout models, researchers should employ a multi-modal approach:

  • Electron microscopy (EM): Essential for quantifying PSD (postsynaptic density) numbers in different hippocampal layers. For statistical validity, at least six frames should be imaged for each animal, with each frame taken as an "n" of 1 .

  • Electrophysiological analyses: Implement both field recordings and whole-cell patch-clamp to assess synaptic transmission and plasticity:

    • Field recordings to measure population responses and short-term plasticity

    • Whole-cell recordings to analyze miniature excitatory postsynaptic currents (mEPSCs)

    • Use at least 3-5 animals per experimental group

  • Statistical considerations:

    • Test for normality using D'Agostino-Pearson omnibus normality test

    • Apply two-way ANOVA for testing both genotype and additional factors

    • Implement Holm-Sidak multiple comparison for post-hoc analysis

  • Immunohistochemical analysis: Use c-fos staining to measure neuronal activity under baseline and anxiety-inducing conditions across multiple brain regions .

These methodological approaches should be combined to provide complementary data on both structural and functional synaptic changes in Lrrc4c knockout models.

How does Lrrc4c deletion affect neuronal activity patterns in specific brain regions?

Lrrc4c deletion leads to significant alterations in neuronal activity across multiple brain regions, revealed through c-fos staining:

Under baseline conditions, c-fos signals in Lrrc4c−/− brains were substantially decreased in multiple cortical and subcortical regions compared to wild-type mice:

  • Anterior cingulate cortex (ACC)

  • Motor cortex (MO)

  • Piriform cortex (PIR2)

  • Endopiriform nucleus (EPd)

  • Retrosplenial area (RSP)

  • Primary somatosensory area (SSp)

  • Paraventricular nucleus of the thalamus (PVT)

  • Dorsal regions of the hippocampus (dDG, dCA3, dCA1)

Interestingly, the ventral regions of the hippocampus didn't show decreased c-fos signals. Only two regions—the lateral septum (LS) and ventral CA3 (vCA3)—showed modestly increased c-fos levels under baseline conditions .

This pattern of altered neuronal activity may underlie the behavioral phenotypes observed in Lrrc4c−/− mice, particularly the anxiolytic-like behavior and hyperactivity.

What molecular mechanisms explain the input-independent effects of Lrrc4c deletion on synaptic function?

The paradoxical finding that Lrrc4c deletion affects both SLM and SR layers despite LRRC4C's enrichment in SLM involves several molecular mechanisms:

  • NGL-2 translocation: Lrrc4c deletion causes abnormal translocation of NGL-2 from the SR to SLM layer. This translocation likely compensates for LRRC4C loss but disrupts NGL-2's normal function in SR .

  • NMDA receptor subunit changes: Lrrc4c deletion leads to:

    • Decreased GluN2B levels in the hippocampus

    • No changes in GluN1 or GluN2A levels

  • Preserved AMPA receptor composition: No differences were found between genotypes in:

    • GluA1 and GluA2 subunits

    • PSD-95 (excitatory postsynaptic scaffold)

  • Normal signaling molecules: PKCα, CamKIIα, and CamKIIβ—signaling molecules associated with short-term plasticity—were unaltered in Lrrc4c−/− hippocampus .

The input-independent effects are therefore likely mediated by a combination of NGL family protein redistribution and NMDA receptor subunit composition changes, rather than by alterations in basic postsynaptic scaffolding or signaling molecules.

How do the effects of Lrrc4c deletion differ between dorsal and ventral hippocampus?

Lrrc4c deletion produces distinct effects in dorsal versus ventral hippocampus:

ParameterVentral HippocampusDorsal Hippocampus
PSD numbersDecreased in both SLM and SR layersChanges absent or modest
Short-term synaptic plasticitySuppressed in both SLM and SR excitatory synapsesMinimal changes
NGL-2 translocationSignificant redistribution from SR to SLMLess pronounced effects
GluN2B levelsMarkedly decreasedLess affected

This dorsal-ventral dissociation has important implications:

  • The ventral hippocampus is more involved in emotional processing, which aligns with the anxiolytic phenotype of Lrrc4c−/− mice .

  • These findings suggest that experimental design for studying LRRC4C function should consider hippocampal subregion specificity rather than treating the hippocampus as a homogeneous structure .

  • The more pronounced effects in ventral hippocampus may explain why certain behavioral domains (anxiety, emotional responses) are more affected than others (object recognition) in Lrrc4c−/− mice .

What are the optimal protocols for reconstitution and handling of recombinant mouse LRRC4C protein?

For optimal experimental outcomes when working with recombinant mouse LRRC4C protein:

Reconstitution protocol:

  • Reconstitute lyophilized protein at a concentration of 0.2 mg/ml in sterile water

  • Centrifuge the vial at 4°C before opening to recover the entire contents

  • For long-term storage, prepare aliquots to avoid repeated freeze-thaw cycles

Storage conditions:

  • Store under sterile conditions at -20°C to -80°C

  • Samples remain stable for up to twelve months from date of receipt when stored at -70°C

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

Quality control parameters:

  • Verify purity (should be >95% as determined by SDS-PAGE)

  • Check endotoxin levels (should be <1.0 EU per μg protein as determined by the LAL method)

  • When possible, confirm biological activity through appropriate functional assays

Experimental considerations:

  • For cell culture applications, protein should be freshly reconstituted or used from minimally thawed aliquots

  • When designing binding studies, consider that the His-tag may influence binding kinetics

  • For in vivo applications, filter through 0.22 μm filter before administration

How can recombinant LRRC4C be utilized to study neuropsychiatric disorders?

Recombinant LRRC4C provides valuable tools for investigating neuropsychiatric disorders through multiple research approaches:

  • Molecular interaction studies: Recombinant LRRC4C can be used to identify binding partners relevant to neuropsychiatric disorders. LRRC4C has been implicated in bipolar disorder, autism spectrum disorders, and developmental delay .

  • Cell-based assays: Applying recombinant LRRC4C to cultured neurons can:

    • Modulate excitatory synapse formation

    • Alter dendritic spine morphology

    • Affect synaptic protein clustering

  • Rescue experiments: In Lrrc4c−/− models, recombinant protein can be used for rescue experiments to confirm phenotype specificity:

    • AAV-mediated delivery of LRRC4C to specific brain regions

    • Direct infusion of soluble recombinant LRRC4C

    • Targeted expression in specific neuronal populations

  • Biomarker development: Antibodies against recombinant LRRC4C can be used to develop assays for detecting LRRC4C in patient samples.

  • Structural biology: Purified recombinant LRRC4C enables structural studies to identify potential binding sites for therapeutic intervention.

Copy number variations in LRRC4C have been identified in individuals with autism spectrum disorders and developmental delays , making it a valuable target for translational neuroscience research.

What is the relationship between LRRC4C and NMDAR-dependent synaptic plasticity?

LRRC4C plays a critical role in NMDAR-dependent synaptic plasticity through several mechanisms:

  • NMDA receptor subunit regulation: Lrrc4c deletion leads to decreased GluN2B levels in the hippocampus without affecting GluN1 or GluN2A levels . GluN2B is crucial for certain forms of synaptic plasticity.

  • Pathway-specific plasticity: LRRC4C mediates NMDAR-dependent synaptic plasticity (Long-Term Potentiation) by binding to the subunits of NMDAR (GluN1, GluN2A, and GluN2B) .

  • Input-specific effects: While LRRC4C is enriched in the SLM layer, its deletion affects synaptic plasticity in both SLM and SR layers of the hippocampus , suggesting complex cross-talk between synaptic inputs.

  • Behavioral correlates: The impaired spatial and working memory in Lrrc4c−/− mice is consistent with disrupted NMDAR-dependent plasticity, particularly in the temporoammonic pathway which is associated with working memory .

  • Molecular mechanism: LRRC4C regulates the formation of excitatory synapses via recruitment of PSD-95 to the cytoplasmic domain after aggregation of LRRC4 at the surface , which indirectly affects NMDAR function and signaling.

These findings suggest that LRRC4C serves as a critical regulator of NMDAR-dependent plasticity, potentially through both direct interactions with NMDAR subunits and indirect effects via modulation of the postsynaptic scaffold.

How does LRRC4C function differ from other NGL family members in synaptic development?

LRRC4C (NGL-1) exhibits distinct functions compared to other NGL family members (NGL-2/LRRC4 and NGL-3/LRRC4B) in synaptic development:

PropertyLRRC4C/NGL-1LRRC4/NGL-2LRRC4B/NGL-3
Primary ligandNetrin-G1Netrin-G2LAR family receptor PTPs
Synaptic specificityModerately input-specificHighly input-specificLess input-specific
Effect on synapse developmentModerateStrongModerate
Hippocampal distributionEnriched in SLMEnriched in SRMore uniform
Input pathwayDirect input to CA1Indirect input to CA1Multiple pathways
Deletion phenotypeInput-independent effectsInput-specific effectsLess characterized

Key functional differences:

  • While NGL-2 (LRRC4) is critical for excitatory synapse development in specific dendritic segments of neurons in an input-specific manner, LRRC4C (NGL-1) deletion leads to more generalized effects, surprisingly affecting both SLM and SR layers despite its enrichment in SLM .

  • LRRC4 (NGL-2) regulates only the formation of Schaffer collateral synapses in the SR, thereby mediating the indirect channel of CA1 information input. In contrast, LRRC4C (NGL-1) is involved in temporo-ammonic pathway synapses but affects multiple pathways when deleted .

  • LRRC4C shares 54-55% amino acid identity with family members LRRC4/NGL-2 and LRRC4B/NGL-3, but each recognizes different ligands , suggesting divergent roles in trans-synaptic signaling.

This functional divergence among NGL family members highlights the specialized roles they play in organizing excitatory synaptic connections in the mammalian brain.

What are common challenges in generating consistent results with recombinant LRRC4C in synaptic assays?

Researchers frequently encounter several challenges when using recombinant LRRC4C in synaptic assays:

  • Protein activity variability:

    • Recombinant proteins may lose activity during storage or freeze-thaw cycles

    • Solution: Aliquot freshly reconstituted protein and avoid repeated freeze-thaw cycles

    • Validate activity in simple binding assays before complex experiments

  • Concentration-dependent effects:

    • At high concentrations, recombinant LRRC4C may exhibit non-physiological effects

    • Solution: Perform careful dose-response experiments (typically starting at 1-100 nM)

    • Include appropriate controls with other LRR-containing proteins

  • Tag interference:

    • His-tagged proteins may show altered binding characteristics

    • Solution: When possible, compare tagged and untagged versions

    • Consider using alternative tagging strategies (e.g., Fc fusion) for certain applications

  • Solubility issues:

    • Recombinant LRRC4C may form aggregates affecting function

    • Solution: Centrifuge at 10,000g for 10 minutes before use

    • Add low concentrations of detergent (0.01% Tween-20) if appropriate for the assay

  • Reproducibility challenges:

    • Different batches may show variable activity

    • Solution: Standardize across batches using quantitative binding assays

    • Consider pooling multiple batches for long-term studies

  • Competing endogenous ligands:

    • In cell culture, endogenous netrin-G1 may compete with experimental manipulations

    • Solution: Use netrin-G1-deficient cell lines or knockdown approaches

These challenges can be addressed through careful experimental design and appropriate controls to ensure reproducible results when working with recombinant LRRC4C.

How can researchers reconcile contradictory findings about LRRC4C functions in different experimental systems?

When confronting contradictory findings about LRRC4C functions across different experimental systems, researchers should employ these systematic approaches:

  • Consider brain region specificity:

    • LRRC4C deletion produces distinct effects in dorsal versus ventral hippocampus

    • Solution: Explicitly define and compare brain regions in studies

    • Example: The ventral hippocampus shows more pronounced effects in PSD numbers and synaptic plasticity compared to dorsal hippocampus in Lrrc4c−/− mice

  • Analyze developmental timing:

    • LRRC4C may have different functions during development versus in adult brain

    • Solution: Use inducible knockout systems to distinguish between developmental and acute effects

    • Perform age-matched comparisons across studies

  • Evaluate compensation mechanisms:

    • NGL-2 translocation from SR to SLM after LRRC4C deletion suggests compensatory mechanisms

    • Solution: Analyze expression of other NGL family proteins in your experimental system

    • Consider double or triple knockouts to minimize compensation

  • Characterize background strain differences:

    • Mouse genetic background can significantly influence synaptic phenotypes

    • Solution: Use consistent genetic backgrounds or systematically compare different backgrounds

    • Report complete strain information in publications

  • Standardize protein preparations:

    • Different recombinant protein preparations may have varying activities

    • Solution: Validate protein activity using standardized binding assays

    • Share protein resources between laboratories for direct comparisons

By systematically addressing these factors, researchers can better understand the source of contradictory findings and develop a more unified model of LRRC4C function.

What novel approaches could advance our understanding of LRRC4C's role in neurodevelopmental disorders?

Several innovative approaches hold promise for elucidating LRRC4C's role in neurodevelopmental disorders:

  • Patient-derived models:

    • Generate iPSC-derived neurons from patients with LRRC4C mutations or copy number variations

    • Develop isogenic lines using CRISPR/Cas9 to correct or introduce specific LRRC4C variants

    • Compare synaptic development and function in 2D and 3D culture systems

  • Circuit-specific manipulations:

    • Implement projection-specific optogenetic studies in Lrrc4c−/− mice

    • Use dual-color circuit tracing to visualize specific inputs affected by LRRC4C deletion

    • Combine in vivo calcium imaging with behavioral paradigms to link circuit dynamics to behavior

  • Multi-omics approaches:

    • Apply spatial transcriptomics to map regional changes in gene expression in Lrrc4c−/− brains

    • Use phosphoproteomics to identify signaling pathways altered by LRRC4C deletion

    • Implement proximity labeling (BioID, APEX) to identify region-specific LRRC4C interactors

  • Advanced imaging methods:

    • Apply super-resolution microscopy to visualize LRRC4C nanoscale organization at synapses

    • Use live-cell single-molecule tracking to monitor LRRC4C dynamics during synapse formation

    • Implement expansion microscopy to map LRRC4C distribution relative to other synaptic proteins

  • Translational approaches:

    • Develop small molecules or peptides that modulate LRRC4C-netrin-G1 interactions

    • Test AAV-mediated LRRC4C delivery as a potential therapeutic approach

    • Identify biomarkers of LRRC4C dysfunction in accessible patient samples

These approaches would provide complementary insights into LRRC4C function and potentially identify novel therapeutic targets for LRRC4C-associated neurodevelopmental disorders.

How might understanding LRRC4C biology contribute to therapeutic strategies for neuropsychiatric disorders?

Understanding LRRC4C biology offers several promising avenues for therapeutic development in neuropsychiatric disorders:

  • Targeted modulation of excitatory/inhibitory balance:

    • LRRC4C deletion affects excitatory synaptic transmission and neuronal excitability

    • Therapeutic potential: Compounds that normalize excitatory synapse function could counteract LRRC4C deficiency

    • Approach: Screen for molecules that enhance excitatory synapse formation in LRRC4C-deficient neurons

  • Circuit-specific interventions:

    • LRRC4C affects specific hippocampal circuits differentially (ventral > dorsal)

    • Therapeutic potential: Circuit-targeted neuromodulation approaches

    • Approach: Develop viral vectors with region-specific promoters for targeted LRRC4C delivery

  • Anxiety and hyperactivity treatment:

    • Lrrc4c−/− mice show hyperactivity and anxiolytic-like behavior

    • Therapeutic potential: LRRC4C pathway modulators could address hyperactivity disorders

    • Approach: Test existing ADHD medications in Lrrc4c−/− mice to identify effective treatments

  • Cognitive enhancement strategies:

    • LRRC4C is important for working and spatial memory

    • Therapeutic potential: LRRC4C enhancers might improve cognitive function

    • Approach: Screen for compounds that enhance LRRC4C-mediated synaptic plasticity

  • Biomarker development:

    • LRRC4C dysfunction affects widespread brain regions

    • Therapeutic potential: LRRC4C-related markers could stratify patients for targeted treatments

    • Approach: Identify accessible biomarkers (e.g., in CSF) that correlate with LRRC4C pathway dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.