Recombinant Mouse Leucine-rich repeat-containing protein 8B (Lrrc8b)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Variants

Recombinant mouse LRRC8B is produced in multiple systems, with variations in tags and purity (Table 1):

Table 1: Recombinant Mouse LRRC8B Variants

SourceHost SystemTagPurityLength (aa)Reference
Creative BioMartE. coliHis>90%1-791
AliCE®Cell-free (Tobacco)Strep70-80%1-803
HEK293Mammalian cellsHis/Fc/Avi>90%Full length
  • Expression systems:

    • E. coli: Cost-effective for large-scale production but lacks post-translational modifications .

    • Mammalian cells (HEK293): Suitable for functional studies requiring native folding .

    • Cell-free systems: Enable rapid production of difficult-to-express proteins .

Calcium Signaling and ER Homeostasis

  • Overexpression of LRRC8B in HEK293 cells reduces ER calcium stores and attenuates IP3-mediated calcium release .

  • LRRC8B knockdown slows ER calcium depletion during thapsigargin-induced stress .

Immune Regulation

  • LRRC8B-deficient T cells exhibit hyperproliferation and increased cytokine production due to impaired cGAMP uptake and STING-p53 signaling .

  • Lrrc8b ⁻/⁻ mice show exacerbated autoimmune responses, highlighting its role in immune suppression .

Disease Associations

  • While LRRC8A is linked to cancer prognosis , LRRC8B’s role in male fertility is inferred from studies on Lrrc8a ⁻/⁻ mice, where VRAC dysfunction causes sperm midpiece defects and infertility .

Technical Considerations

  • Storage: Lyophilized LRRC8B is stable at -80°C but requires reconstitution in Tris/PBS buffers with trehalose or glycerol to prevent aggregation .

  • Functional assays: Used in patch-clamp studies to characterize VRAC currents and in calcium imaging to probe ER dynamics .

Future Directions

Current research gaps include resolving LRRC8B’s cryo-EM structure and identifying pharmacological modulators. Its interplay with LRRC8A in diseases like cancer and autoimmunity warrants further exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize development based on your preference.
Synonyms
Lrrc8b; Kiaa0231; Volume-regulated anion channel subunit LRRC8B; Leucine-rich repeat-containing protein 8B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-791
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lrrc8b
Target Protein Sequence
MITLTELKCLADAQSSYHILKPWWDVFWYYITLIMLLVAVLAGALQLTQSRVLCCLPCKV EFDNQCAVPWDLLKGSENASSNSGLLLPLPLRIQNDLHRQQYSYIDAVCYEKQLHWFAKF FPYLVLLHTLIFAACSNFWLHYPSTSSRLEHFVSILHKCFDSPWTTRALKLSKSKTLLST SGGSADIDASKQSLPYPQPGLESPGIESPTSSVLDKKEGEQAKAIFEKVKRFRLHVEQRD IIYRVYLKQIIVKVILFVLIITYVPYFLSYITLEIDCSIDVQAFTGYKRYQCVYSLAEIF KVLASFYVILVMLYGLTSSYSLWWMLRSSLKQYSFEALREKSNYSDIPDVKNDFAFILHL ADQYDPLYSKRFSIFLSEVSENKLKQINLNNEWTVERLKSKLVKNSQDKVELHLFMLNGL PDNVFELTEMEVLSLELIPEVKLPAAVAQLVNLRELHVYHSSLVVDHPALAFLEENLRIL RLKFTEMGKIPRWVFHLKNLKELYLSGCVLPEQLSSLHLEGFQDLKNLRTLYLKSSLSRI PQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLELLSCDLERIPHSIFSLNNLHE LDLKENNLKTVEEIISFQHLPSLSCLKLWHNNIAYIPAQIGALSNLEQLFLGHNNIESLP LQLFLCTKLHYLDLSYNHLTFIPEEIQYLTNLQYFAVTNNNIEMLPDGLFQCKKLQCLLL GRNSLTDLSPLVGELSNLTHLELTGNYLETLPVELEGCQSLKRSCLIVEDSLLNSLPLPV AERLQTCLDKC
Uniprot No.

Target Background

Function
LRRC8B is a non-essential component of the volume-regulated anion channel (VRAC, also known as VSOAC channel). This channel plays a crucial role in maintaining constant cell volume in response to osmotic changes in the extracellular or intracellular environment. The VRAC channel exhibits greater conductivity for iodide compared to chloride and can also transport organic osmolytes like taurine. Channel activity requires LRRC8A in conjunction with at least one other family member (LRRC8B, LRRC8C, LRRC8D, or LRRC8E). The specific subunit composition determines the channel characteristics.
Database Links
Protein Families
LRRC8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane.

Q&A

What is the basic structure of mouse LRRC8B and how does it compare to other LRRC8 family members?

Mouse LRRC8B is a transmembrane protein that shares structural homology with other LRRC8 family members. The protein contains four transmembrane domains (TMD), an intracellular N-terminus, and a C-terminal domain containing leucine-rich repeats (LRR). While specific structural data on LRRC8B is limited, the protein shares a minimum of 37% sequence homology with other LRRC8 subunits, with the highest similarity to LRRC8A .

The LRRC8 proteins generally feature a short N-terminal cytoplasmic domain, followed by the four TMDs and an extensive C-terminal region containing 15-17 leucine-rich repeats. These LRR domains form long twisting arches spanning approximately 80 Å in length, creating a distinctive structural feature that likely contributes to protein-protein interactions and channel function .

What is the functional role of LRRC8B in Volume Regulated Anion Channels (VRAC)?

LRRC8B functions as a modulatory subunit in heteromeric VRAC complexes. Unlike LRRC8A, which is essential for VRAC activity, LRRC8B cannot form functional channels alone but contributes to channel diversity and functional properties when assembled with LRRC8A .

How is LRRC8B expression regulated in different mouse tissues?

While the search results do not provide specific data on LRRC8B tissue expression patterns, studies on the LRRC8 family indicate that these proteins are widely expressed across vertebrate tissues. Like other LRRC8 family members, LRRC8B likely exhibits tissue-specific expression patterns that contribute to the functional diversity of VRAC channels in different cell types.

Research methodologies to determine tissue-specific expression include quantitative PCR, Western blotting, and immunohistochemistry using LRRC8B-specific antibodies. When investigating expression patterns, researchers should consider developmental stage, physiological condition, and potential compensatory mechanisms among LRRC8 family members .

What are the optimal conditions for recombinant expression of mouse LRRC8B?

For successful recombinant expression of mouse LRRC8B, researchers should consider several factors:

  • Expression system selection: Mammalian expression systems (HEK293, CHO cells) are preferred over bacterial systems due to the complex transmembrane nature of LRRC8B and requirements for proper folding and post-translational modifications.

  • Co-expression considerations: Since LRRC8B requires LRRC8A for proper membrane trafficking, co-expression with LRRC8A may be necessary for functional studies .

  • Expression vector design: Vectors should include appropriate tags (His, FLAG, or GFP) for detection and purification without disrupting protein function. C-terminal tags are generally preferred as the N-terminus may be critical for channel function .

  • Transfection optimization: Lipid-based transfection methods typically yield better results for membrane proteins compared to calcium phosphate methods.

When evaluating expression, Western blotting and fluorescence microscopy (for tagged constructs) should be employed to confirm proper expression levels and subcellular localization.

What electrophysiological approaches are most effective for characterizing LRRC8B-containing VRAC channels?

Electrophysiological characterization of LRRC8B-containing VRAC channels requires specialized techniques:

  • Patch-clamp recording: Whole-cell patch-clamp remains the gold standard for functional characterization of VRAC currents. This approach allows measurement of hypotonic solution-activated outwardly rectifying anion currents that are characteristic of VRAC channels .

  • Experimental conditions:

    • Hypotonic solutions (typically 70-75% of isotonic osmolarity) to activate VRAC

    • Symmetric or asymmetric Cl⁻ concentrations to evaluate ion selectivity

    • Voltage step protocols from -100 mV to +100 mV to assess outward rectification properties

  • Comparative analysis: Experiments should include comparison between:

    • LRRC8A/LRRC8B heteromers

    • LRRC8A homomers

    • LRRC8A with other LRRC8 subunits

Data analysis should focus on current amplitude, activation kinetics, inactivation at positive potentials, ion selectivity, and pharmacological sensitivity .

How can researchers effectively distinguish the contribution of LRRC8B from other LRRC8 subunits in VRAC function?

Distinguishing the specific contribution of LRRC8B in VRAC function requires multiple complementary approaches:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated knockout of individual LRRC8 genes

    • siRNA-mediated knockdown with LRRC8B-specific targeting sequences

    • Rescue experiments with wild-type or mutant LRRC8B in knockout backgrounds

  • Subunit-specific pharmacology:

    • While no LRRC8B-specific inhibitors have been identified, differential sensitivity to general VRAC blockers (DCPIB, tamoxifen, fluoxetine) may provide indirect evidence of subunit composition

  • Biophysical characterization:

    • Single-channel conductance analysis, which may vary depending on subunit composition

    • Ion selectivity measurements comparing I⁻/Cl⁻ permeability ratios

    • Inactivation kinetics at positive potentials, which show subunit-dependent variation

  • Subunit co-immunoprecipitation approaches to determine physical interactions between LRRC8B and other VRAC components

How do specific domains of LRRC8B contribute to VRAC channel properties?

Understanding domain-specific contributions of LRRC8B to VRAC function requires targeted mutagenesis and chimeric approaches:

  • N-terminal domain: The N-terminal region of LRRC8 proteins influences pore properties and gating. Studies with other LRRC8 subunits have shown that residues in positions 2-14 are particularly important, with mutations at positions 2-4 often abolishing channel function . For LRRC8B, similar conserved residues likely play crucial roles in channel conductance and ion selectivity.

  • Transmembrane domains: The TMDs form the channel pore and determine ion conductance properties. Particularly important are the extracellular loops connecting TMDs, which influence ion selectivity and voltage-dependent inactivation kinetics .

  • Leucine-rich repeat domains: The LRR domains (15-17 repeats) form structures spanning approximately 80 Å in length. In LRRC8A, these domains arrange to create fenestrations that may serve as entry points for ions and osmolytes. Similar structural features are likely present in LRRC8B, potentially with subunit-specific configurations that affect channel regulation .

Methodological approaches should include:

  • Cysteine-scanning mutagenesis with subsequent modification by MTS reagents

  • Creation of chimeric constructs swapping domains between different LRRC8 subunits

  • Structure-guided point mutations targeting conserved residues

How does the stoichiometry of LRRC8A and LRRC8B affect VRAC properties?

The stoichiometry of LRRC8 subunits within heteromeric complexes significantly influences channel properties:

  • Functional VRACs are hexameric assemblies containing at least one LRRC8A subunit combined with other LRRC8 proteins (B-E) . The ratio of LRRC8A to LRRC8B in these complexes can vary, creating channels with diverse functional properties.

  • Experimental approaches to control and assess stoichiometry include:

    • Tandem constructs linking LRRC8A and LRRC8B in defined arrangements

    • Tetracysteine tags and FlAsH labeling for quantitative assessment of subunit incorporation

    • Single-molecule photobleaching of fluorescently tagged subunits

    • Blue native PAGE analysis of assembled complexes

  • Functional consequences of varying stoichiometry can be assessed by:

    • Ion selectivity measurements, particularly for organic osmolytes

    • Activation and inactivation kinetics

    • Single-channel conductance properties

    • Sensitivity to pharmacological modulators

What is the role of LRRC8B-containing VRAC channels in immune cell function?

The role of LRRC8B in immune function remains incompletely characterized, but insights can be drawn from studies of the LRRC8 family:

How does LRRC8B contribute to cell volume regulation in different tissues?

Cell volume regulation is the canonical function of VRAC channels, with LRRC8B likely contributing tissue-specific properties:

  • In response to cell swelling, VRAC channels activate to allow efflux of anions and organic osmolytes, facilitating regulatory volume decrease (RVD) . The contribution of LRRC8B to this process may vary by tissue, depending on its expression level and partnership with other LRRC8 subunits.

  • Experimental approaches to assess LRRC8B-specific contributions include:

    • Cell volume measurements using calcein fluorescence quenching

    • Radioisotope efflux assays to measure release of organic osmolytes

    • Live-cell imaging with fluorescent volume indicators

    • Patch-clamp recording of swelling-activated currents in tissues with differential LRRC8B expression

  • Tissue-specific functions may be investigated using:

    • Conditional knockout models targeting LRRC8B in specific tissues

    • Primary cell cultures from different organs of LRRC8B-deficient animals

    • Organoid models to assess three-dimensional tissue responses

What are the most effective antibodies and detection methods for studying mouse LRRC8B?

Effective detection of LRRC8B requires careful selection of antibodies and methods:

What knockout/knockdown approaches are most suitable for studying LRRC8B function?

Multiple genetic manipulation approaches can be employed to study LRRC8B function:

  • CRISPR/Cas9 gene editing:

    • Complete knockout through frameshift mutations

    • Knock-in of point mutations to study structure-function relationships

    • Introduction of fluorescent tags at endogenous loci

  • RNA interference:

    • siRNA for transient knockdown in cell culture

    • shRNA for stable knockdown in long-term studies

    • Optimization of target sequences to avoid off-target effects

  • Animal models:

    • Conventional knockout mice

    • Conditional knockout using Cre-loxP systems for tissue-specific deletion

    • Knockin mice expressing mutant LRRC8B variants

  • Experimental design considerations:

    • Potential compensatory upregulation of other LRRC8 family members

    • Phenotypic assessment across multiple tissues due to widespread expression

    • Combined knockdown of multiple LRRC8 subunits may be necessary to reveal functional roles

How can researchers effectively study the interaction between LRRC8B and other VRAC components?

Studying LRRC8B interactions requires multiple complementary approaches:

  • Biochemical methods:

    • Co-immunoprecipitation with subunit-specific antibodies

    • Pull-down assays using tagged recombinant proteins

    • Chemical cross-linking to capture transient interactions

    • Blue native PAGE to analyze intact complexes

  • Imaging techniques:

    • FRET between fluorescently tagged subunits

    • Bimolecular fluorescence complementation (BiFC)

    • Super-resolution microscopy to visualize subunit co-localization

    • Single-molecule tracking to assess complex dynamics

  • Functional assays:

    • Electrophysiological recording of channels with defined subunit composition

    • Ion selectivity measurements to identify functional signatures of specific subunit combinations

    • Pharmacological profiling of different subunit combinations

  • Structural approaches:

    • Cryo-EM analysis of purified complexes, similar to studies performed with LRRC8A and LRRC8D

    • Computational modeling based on homology with resolved structures of other LRRC8 subunits

How does dysfunction of LRRC8B-containing VRAC channels contribute to disease models?

Understanding the pathophysiological implications of LRRC8B dysfunction requires investigation across multiple disease contexts:

  • Potential disease associations:

    • Immune disorders: Given the role of LRRC8 proteins in lymphocyte development, LRRC8B dysfunction might contribute to immune dysregulation

    • Neurological disorders: VRAC channels regulate cell volume in neural tissues and may affect excitability

    • Metabolic disorders: VRAC-mediated transport of organic osmolytes could influence metabolic pathways

  • Experimental disease models:

    • LRRC8B knockout mice challenged with disease-inducing conditions

    • Cell culture models expressing disease-associated LRRC8B variants

    • Patient-derived samples with altered LRRC8B expression or function

  • Methodological approaches:

    • Phenotypic characterization of LRRC8B-deficient animals under physiological stress

    • Pharmacological modulation of VRAC activity in disease models

    • Correlation of LRRC8B expression with disease progression in clinical samples

What therapeutic approaches might target LRRC8B-containing VRAC channels?

Therapeutic targeting of LRRC8B-containing channels presents both opportunities and challenges:

  • Potential therapeutic strategies:

    • Small molecule modulators that selectively target LRRC8B-containing channels

    • Peptide inhibitors derived from critical interaction domains

    • Gene therapy approaches to correct dysfunction or restore expression

  • Target validation approaches:

    • Phenotypic rescue experiments in disease models

    • Structure-based drug design targeting subunit-specific interfaces

    • High-throughput screening for subunit-selective modulators

  • Challenges in therapeutic development:

    • Achieving selectivity for LRRC8B-containing channels over other VRAC configurations

    • Potential compensatory mechanisms involving other LRRC8 family members

    • Tissue-specific targeting to avoid systemic effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.