Recombinant Mouse Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (Lrit2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Neurobiology

Lrit2 is enriched in striatonigral neurons (SPNs) of the basal ganglia, where it regulates:

  • GABAergic signaling: Modulates GAD67 (glutamic acid decarboxylase) and GABA<sub>B</sub> receptor distribution in the substantia nigra pars reticulata (SNr) .

  • Axonal protein sorting: Controls subcellular localization of synaptic proteins via cytoplasmic sorting motifs .

  • Motor coordination: Knockout (KO) mice exhibit hyperactivity, impaired motor learning, and altered dopamine metabolism .

Research Findings from Lrit2 Knockout Studies

Key outcomes from Frontiers in Molecular Neuroscience (2022) :

ParameterWild-Type (WT)Lrit2 KOSignificance (p-value)
GAD67 particles (striatum)1,200 ± 1501,600 ± 200<0.01
GABA<sub>B</sub>R1 density900 ± 1001,300 ± 150<0.05
Dopamine (ng/mg tissue)12.5 ± 1.28.7 ± 0.9<0.001
Motor learning latency120 ± 15 sec180 ± 20 sec<0.01

Applications in Biomedical Research

  • Antibody validation: Used as a control fragment in Western blot (WB) and immunocytochemistry (ICC) to block nonspecific binding .

  • ELISA development: MBS9324835 ELISA kit detects native Lrit2 in biological samples with intra-assay CV <10% .

  • Neurological studies: Investigates protein trafficking defects in Parkinson’s disease models .

Challenges and Future Directions

  • Species specificity: Antibodies against mouse Lrit2 show cross-reactivity with human LRIT2 but require validation .

  • Therapeutic potential: Role in dopamine regulation suggests relevance to neurodegenerative diseases, but in vivo delivery mechanisms remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Lrit2; Lrrc22; Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2; Leucine-rich repeat-containing protein 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-549
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Lrit2
Target Protein Sequence
FCLPECTCSEESFGRSLQCMSMSLGKIPDNFPEELKQVRIENSPLFELSQGFFTNMSSLE YLWLNFNNVTVIHLGALEDLPELRELRLEGNKLRSVPWTAFRATPLLRVLDLKHNRIDSV PELALQFLTNLIYLDISSNRLTVVSKGVFLNWPAYQKRQQLGCGAEFLSNMVLSLHNNPW LCDCRLRGLAQFVKSVGPPFILVNSYLVCQGPVSKAGQLLHETELGVCMKPTISTPSVNV TIQVGKNVTLQCFAQASPSPTIAWKYPLSTWREFDVLASPIAEGIILSQLVIPAAQLVDG GNYTCMAFNSIGRSSLVILLYVQPAQAMPGLHFLSTSSEVSAYVDLRVVKQTVHGILLQW LTVTNLAEEQWFTLYITSDEALRKKVVHIGPGINTYAVDDLLPATKYKACLSLRNQPPSQ GQCVVFVTGKDSGGLEGREHLLHVTVVLCAVLLALPVGAYVWVSQGPYNFSEWCWRRCPL HRKTLRCPQAVPQCKDNSFKDPSGVYEDGESHRVMEEDEEVEKEGIS
Uniprot No.

Target Background

Gene References Into Functions
  1. Lrit2 is dispensable for photoreceptor synapse formation. PMID: 29590622
Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the domain architecture of mouse Lrit2 and how does it compare to other leucine-rich repeat proteins?

Mouse Lrit2 belongs to the leucine-rich repeat (LRR) protein family, containing distinctive immunoglobulin-like and transmembrane domains. Similar to LRRK2, Lrit2's structure likely facilitates multiple protein-protein interactions through its tandem repeat domains. Leucine-rich repeats are evolutionarily preferred mechanisms that allow adaptation to changing environments by forming stable protein scaffolds for interactions . While LRRK2 contains Armadillo, Ankyrin, Leucine-rich repeats and a WD40 domain , Lrit2 features a specific arrangement of LRR domains combined with immunoglobulin-like and transmembrane domains that define its unique functional properties.

When analyzing the domain architecture, researchers should:

  • Perform sequence alignment with related proteins

  • Use structure prediction tools to identify conserved motifs

  • Map functional domains using deletion constructs in expression systems

What expression patterns does Lrit2 exhibit in different mouse tissues and developmental stages?

While specific Lrit2 expression data is not directly provided in the search results, researchers studying LRR proteins typically analyze expression patterns using complementary techniques:

  • RNA-seq and qPCR for tissue-specific expression profiling

  • In situ hybridization for spatial localization during development

  • Western blotting for protein-level quantification

  • Immunohistochemistry for cellular/subcellular localization

For developmental studies, time-course analysis across embryonic stages and postnatal development provides crucial information about the temporal regulation of Lrit2. Unlike commercial expression assays, research-grade analysis should include validation across multiple biological replicates with appropriate statistical analysis to account for tissue-specific variation.

What methods are most effective for identifying novel Lrit2 protein interaction partners?

Based on successful approaches used for other LRR proteins such as LRRK2, researchers should consider implementing:

  • Co-immunoprecipitation coupled to quantitative mass spectrometry: The QUICK (Quantitative Immune Precipitation combined with Knock-down) approach allows for identification of specific interactors by using target-specific antibodies with appropriate knock-down controls .

  • Yeast two-hybrid screening: This approach has successfully identified multiple domains of self-interaction for LRRK2 , and could be adapted for Lrit2 using specific domains as bait.

  • GST pulldown assays: For validating direct protein-protein interactions identified through other screening methods .

  • Proximity labeling approaches: BioID or APEX2-based methods for identifying transient or weak interactors in living cells.

When conducting interaction studies, it's essential to validate findings through multiple orthogonal methods and confirm the biological relevance of the interactions.

How can researchers determine if Lrit2 forms dimers or multimeric complexes?

Similar to LRRK2, which predominantly exists as a dimer under native conditions , Lrit2 may form multimeric complexes. Researchers should implement the following methodological approach:

  • Size exclusion chromatography: To determine the native molecular weight of Lrit2 complexes in solution.

  • Blue native PAGE: For analysis of intact protein complexes.

  • Crosslinking mass spectrometry: To capture transient interactions and determine complex topology.

  • Co-immunoprecipitation with differently tagged constructs: For example, using GFP-tagged and V5-tagged proteins as demonstrated with LRRK2 .

  • Analytical ultracentrifugation: For precise determination of complex stoichiometry.

The experimental data from LRRK2 studies showed that dimerization can be verified by co-immunoprecipitating N-terminal GFP-tagged and C-terminal V5-tagged proteins , a technique that would be directly applicable to Lrit2 multimerization studies.

What are the critical considerations for designing statistically robust experiments with recombinant Lrit2?

When designing experiments with recombinant Lrit2, researchers should follow these principles:

  • Define clear falsifiable hypotheses: Before beginning any experiment, clearly articulate what specific question you're addressing about Lrit2 function or interactions .

  • Determine appropriate replication: The number of experimental units should be calculated based on:

    • Expected effect size

    • Desired statistical power (typically 0.8)

    • Significance level (α = 0.05 is standard)

  • Randomization strategy: Implement proper randomization to neutralize systematic biases and ensure independence of errors .

  • Treatment structure: When testing different conditions (e.g., Lrit2 concentrations, mutants):

    • Use equal intervals between treatment levels when possible

    • Include sufficient levels to detect complexity in the response

  • Control for batch effects: Include appropriate controls in each experimental batch.

Remember: "You cannot save by analysis what you bungle by design" . Consult with statisticians during the planning stage rather than after data collection.

What expression systems are optimal for producing functional recombinant mouse Lrit2?

The optimal expression system depends on the specific experimental requirements:

Expression SystemAdvantagesLimitationsBest Applications
E. coli- High yield
- Low cost
- Simple setup
- Limited post-translational modifications
- Potential improper folding of LRR domains
- Fragment expression
- Domain interaction studies
Mammalian cells (HEK293, CHO)- Native-like post-translational modifications
- Proper folding
- Appropriate for full-length protein
- Lower yield
- Higher cost
- More complex protocols
- Functional studies
- Cell-based assays
- Interaction studies
Insect cells (Sf9, Hi5)- Higher yield than mammalian
- Most post-translational modifications
- Good folding of complex proteins
- Some glycosylation differences
- Moderate cost
- Structural studies
- Large-scale production
Cell-free systems- Rapid expression
- Avoids toxicity issues
- Limited post-translational modifications
- Lower yield for complex proteins
- Quick screening
- Protein engineering

When expressing transmembrane proteins like Lrit2, mammalian expression systems often provide the most physiologically relevant environment. Similar to studies with LRRK2, researchers may need to optimize constructs with appropriate tags (e.g., Myc, GFP, or V5-His tags) to facilitate detection and purification .

What approaches are most effective for characterizing Lrit2 phosphorylation and other post-translational modifications?

Given that Lrit2 contains leucine-rich repeat domains similar to LRRK2, which undergoes extensive phosphorylation , researchers should implement:

  • Mass spectrometry-based approaches:

    • Phosphoproteomics using TiO₂ enrichment

    • Multiple reaction monitoring (MRM) for targeted quantification

    • Parallel reaction monitoring (PRM) for site-specific analysis

  • In vitro kinase assays:

    • Using purified recombinant Lrit2

    • Testing candidate kinases based on consensus motif analysis

    • Validation with phospho-specific antibodies

  • Site-directed mutagenesis:

    • Generate phospho-mimetic (S/T to D/E) and phospho-deficient (S/T to A) mutants

    • Assess functional consequences in cellular assays

  • Phosphorylation dynamics:

    • Pulse-chase experiments with radioactive phosphate

    • Stimulus-dependent phosphorylation studies

For identifying interacting proteins affected by phosphorylation status, researchers can adapt the approach used for LRRK2, which revealed that phosphorylation affects binding to regulatory proteins like 14-3-3 .

How can researchers investigate the subcellular localization and trafficking of Lrit2?

As a transmembrane protein, Lrit2's subcellular localization and trafficking are crucial aspects of its function. Researchers should implement:

  • Live-cell imaging techniques:

    • Fluorescent protein tagging (ensure tag position doesn't interfere with trafficking signals)

    • Photoactivatable or photoconvertible tags for pulse-chase analysis

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility studies

  • Subcellular fractionation:

    • Differential centrifugation coupled with western blotting

    • Density gradient separation of membrane compartments

    • Extraction methods to distinguish membrane-associated vs. integral proteins

  • Colocalization studies:

    • Immunofluorescence with organelle markers

    • Super-resolution microscopy for detailed localization

    • Proximity ligation assay (PLA) for protein-protein interactions in situ

  • Trafficking dynamics:

    • Endocytosis and recycling assays using surface biotinylation

    • Temperature-block experiments to analyze transport steps

    • Brefeldin A or other inhibitors to probe secretory pathway involvement

When designing these experiments, researchers should consider that transmembrane domain proteins like Lrit2 may require specific detergents for extraction and analysis, similar to considerations for membrane-associated proteins like LRRK2 .

What strategies should be used to investigate the impact of mutations in different Lrit2 domains?

To systematically analyze structure-function relationships in Lrit2:

Drawing from LRRK2 research, where specific mutations like G2019S in the kinase domain and R1441C/G/H in the GTPase domain are associated with Parkinson's disease , researchers should assess how analogous mutations in conserved Lrit2 domains might affect its function and interactions.

How can computational approaches predict the structural impact of Lrit2 mutations?

Computational methods provide valuable insights into Lrit2 structure-function relationships:

  • Homology modeling:

    • Using related leucine-rich repeat proteins as templates

    • Refinement with molecular dynamics simulations

    • Validation through experimental approaches

  • Molecular dynamics simulations:

    • Analyzing the stability of wild-type vs. mutant structures

    • Identifying conformational changes induced by mutations

    • Predicting allosteric effects between domains

  • Protein-protein interaction prediction:

    • Docking studies with potential interaction partners

    • Identification of critical interface residues

    • Effects of mutations on binding energetics

  • Evolutionary analysis:

    • Conservation patterns across species

    • Coevolution analysis to identify functionally linked residues

    • Positive selection analysis to identify adaptively evolving sites

  • Machine learning approaches:

    • Training on known LRR protein mutations

    • Feature extraction from sequence and structural information

    • Prediction of mutation impact on stability and function

When implementing computational approaches, researchers should validate predictions experimentally, as LRRK2 studies have shown that predicted structural changes can be confirmed through biochemical and cell-based assays .

What are the best approaches for studying Lrit2 in the context of signaling pathways?

To investigate Lrit2's role in signaling pathways, researchers should:

  • Pathway perturbation analysis:

    • Overexpression and knockdown/knockout studies

    • Dominant-negative construct design based on domain analysis

    • Pharmacological intervention at various pathway nodes

  • Phosphorylation cascade analysis:

    • Similar to LRRK2's role in the ASK1–MKK3/6–p38 signaling cascade

    • Identification of upstream regulators and downstream effectors

    • Temporal resolution of signaling events

  • Interactome mapping in pathway context:

    • Proximity labeling in specific cellular compartments

    • Stimulus-dependent interaction changes

    • Pathway reconstruction from protein-protein interaction data

  • Reporter assays:

    • Pathway-specific transcriptional reporters

    • FRET/BRET-based activity sensors

    • Bimolecular fluorescence complementation for interaction dynamics

Learning from LRRK2 research, which identified roles in multiple pathways including Wnt/β-catenin signaling , researchers should examine Lrit2 in the context of both established and novel signaling networks, particularly those involving transmembrane signal transduction.

How can single-cell approaches advance our understanding of Lrit2 function?

Single-cell technologies offer powerful tools to dissect heterogeneity in Lrit2 expression and function:

  • Single-cell RNA sequencing:

    • Cell type-specific expression patterns

    • Correlation with other genes to identify functional modules

    • Trajectory analysis for developmental or activation states

  • Single-cell proteomics:

    • Protein expression levels across cell populations

    • Co-expression patterns with interaction partners

    • Post-translational modification heterogeneity

  • Live-cell single-molecule imaging:

    • Tracking of individual Lrit2 molecules in the membrane

    • Analysis of diffusion dynamics and confinement

    • Interaction kinetics with binding partners

  • Patch-clamp electrophysiology (if Lrit2 affects ion channels):

    • Functional consequences of Lrit2 expression

    • Mutation effects on channel modulation

    • Pharmacological sensitivity

When implementing single-cell approaches, researchers should carefully control for technical variability and develop appropriate analytical pipelines to extract meaningful biological insights from complex datasets.

What are the common challenges in producing high-quality recombinant Lrit2 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant Lrit2:

ChallengePossible CausesSolutions
Low expression yield- Protein toxicity
- Codon bias
- Inefficient transcription/translation
- Use inducible expression systems
- Optimize codon usage
- Try different promoters
- Use specialized host strains
Protein misfolding/aggregation- Hydrophobic transmembrane domains
- Incorrect disulfide formation
- Improper chaperone activity
- Lower expression temperature
- Add stabilizing agents (glycerol, arginine)
- Co-express with chaperones
- Use detergents for membrane proteins
Proteolytic degradation- Exposure to host proteases
- Inherent instability
- Add protease inhibitors
- Optimize purification speed
- Identify and mutate protease-sensitive sites
- Use protease-deficient host strains
Poor solubility- Hydrophobic domains
- Improper folding
- Screen detergents systematically
- Use fusion tags (MBP, SUMO)
- Express soluble domains separately
Loss of function- Improper post-translational modifications
- Missing cofactors
- Incorrect folding
- Use mammalian expression systems
- Supplement with required cofactors
- Optimize buffer conditions

Based on experiences with LRRK2, researchers might find that certain domains of Lrit2 (particularly the N-terminal region) may not be stable when expressed in mammalian cells or as recombinant fusion proteins . In such cases, focus on expressing stable domains or optimize construct design based on structural predictions.

What quality control measures are essential for ensuring the reliability of Lrit2 functional assays?

To ensure robust and reproducible results with recombinant Lrit2:

  • Protein quality assessment:

    • Size exclusion chromatography to confirm homogeneity

    • Thermal shift assays to assess stability

    • Circular dichroism to verify secondary structure

    • Mass spectrometry to confirm intact mass and modifications

  • Batch consistency controls:

    • Standardized activity assays for functional benchmarking

    • Reference standards across experiments

    • Detailed documentation of purification procedures

  • Experimental validation:

    • Multiple biological and technical replicates

    • Appropriate positive and negative controls

    • Dose-response relationships to confirm specificity

    • Orthogonal methods to verify key findings

  • Statistical rigor:

    • Power analysis to determine sample size

    • Appropriate statistical tests for data distribution

    • Control for multiple comparisons

    • Visualization of complete datasets rather than representative results

Following principles from experimental design literature, researchers should remember that "the time to think about statistical inference is when the experiment is being planned" and that "proper experimental design is often more important than sophisticated statistical analysis" .

What are the most promising directions for future Lrit2 research?

Based on advances in related LRR protein research, several promising directions emerge:

  • High-resolution structural studies:

    • Cryo-EM structures of full-length Lrit2

    • X-ray crystallography of individual domains

    • Molecular dynamics simulations of conformational changes

  • In vivo functional characterization:

    • Conditional knockout mouse models

    • Tissue-specific expression modulation

    • Phenotypic analysis across multiple systems

  • Therapeutic applications:

    • Development of domain-specific inhibitors or activators

    • Screening for small molecules that modulate Lrit2 function

    • Identification of disease-relevant variants

  • Systems biology approaches:

    • Integration of Lrit2 into protein interaction networks

    • Pathway modeling incorporating Lrit2 function

    • Multi-omics data integration

As demonstrated with LRRK2 research, understanding the detailed mechanisms of protein function through interaction studies, structural analysis, and functional characterization has significant implications for both basic science and potential therapeutic applications .

How can researchers effectively integrate multi-omics data to better understand Lrit2 biology?

A comprehensive understanding of Lrit2 requires integration of multiple data types:

  • Data integration strategies:

    • Network-based approaches connecting genetic, transcriptomic, and proteomic data

    • Machine learning methods to identify patterns across datasets

    • Pathway enrichment analysis incorporating multiple data types

  • Multi-level experimental design:

    • Coordinated sampling for genomics, transcriptomics, proteomics

    • Temporal resolution to capture dynamic processes

    • Spatial resolution through tissue or subcellular fractionation

  • Validation approaches:

    • Targeted experiments to confirm predictions from integrated analysis

    • Perturbation studies to test causal relationships

    • Cross-species validation to identify conserved mechanisms

  • Computational workflow:

    • Standardized data processing pipelines

    • Appropriate normalization methods across platforms

    • Robust statistical approaches for heterogeneous data types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.