Recombinant Mouse Leukocyte surface antigen CD47 (Cd47)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Leukocyte Surface Antigen CD47 (Cd47)

Recombinant mouse CD47 is a genetically engineered protein derived from the murine Cd47 gene (GenBank accession Q61735-2), expressed in mammalian systems such as HEK-293 cells. It represents the extracellular domain (ECD) of the native transmembrane protein, which spans amino acids 19–158 and includes a single Ig-like domain critical for binding to the inhibitory receptor SIRPα. This recombinant form is widely used in immunological and oncological research to study immune evasion mechanisms, phagocytosis regulation, and therapeutic strategies.

Protein Structure

FeatureDescriptionSource
Domain CompositionECD (19–158 aa): Single Ig-like domain, five transmembrane regions, cytoplasmic tail
GlycosylationVariably glycosylated, contributing to molecular weight (40–60 kDa)
Binding MotifsBinds SIRPα (ED50: 5.736 µg/mL) and thrombospondin-1 (THBS1)

The recombinant protein is often truncated to the ECD (e.g., residues 19–140) and appended with tags (e.g., C-terminal 6His) for purification and detection.

Key Functional Roles

  1. Immune Regulation:

    • SIRPα Interaction: CD47 binding to SIRPα on macrophages inhibits phagocytosis via ITIM-mediated signaling, protecting healthy cells from clearance .

    • Immune Checkpoint: Upregulated during infections (e.g., via TLR7/8 signaling) to suppress excessive inflammation but exploited by tumors to evade immunity .

  2. Pathophysiological Relevance:

    • Cancer: Tumor cells overexpress CD47 to block antibody-dependent cellular phagocytosis (ADCP) .

    • Infections: CD47-deficient mice show exacerbated fungal colonization (Candida albicans) and dysregulated inflammatory responses .

In Vitro Assays

Assay TypePurposeRecombinant CD47 Use CaseSource
PhagocytosisMeasure ADCP efficiency in macrophage-tumor cell co-culturesB16F10 melanoma cells opsonized with anti-TRP-1 + A4 (anti-CD47 Nb)
Binding AffinityQuantify SIRPα-CD47 interactionsELISA with immobilized SIRPα-Fc and soluble CD47

Key Findings:

  • Synergistic Antitumor Effects: CD47 blockade (e.g., A4) combined with PD-L1 inhibition enhances melanoma clearance in immunocompetent mice .

  • CD47 Clustering: Lipid raft-associated CD47 on nonapoptotic cells exhibits high SIRPα binding avidity, whereas apoptosis disrupts clustering, enabling phagocytosis .

Infectious Disease Models

  • Fungal Pathogenesis: Cd47 knockout mice show increased C. albicans dissemination and heightened pro-inflammatory cytokines (e.g., TNF-α, IL-6), indicating CD47’s role in limiting tissue damage .

  • Bacterial Immune Modulation: TLR agonists (e.g., R848) upregulate CD47 on macrophages and dendritic cells, imposing a checkpoint that suppresses excessive inflammation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time details.
Note: All protein shipments are dispatched with standard blue ice packs. If you require dry ice packaging, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you require a particular tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cd47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-303
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTD QNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR
Uniprot No.

Target Background

Function
CD47 plays a multifaceted role in cell adhesion, immune modulation, and signal transduction. It functions as an adhesion receptor for thrombospondin-1 (THBS1) on platelets, facilitating cell adhesion. Furthermore, CD47 modulates integrins, contributing to cell signaling pathways. CD47 is crucial for memory formation and synaptic plasticity in the hippocampus. It serves as a receptor for SIRPA, binding to which prevents immature dendritic cell maturation and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation, and costimulates T-cell activation. CD47 may also be involved in membrane transport and/or integrin-dependent signal transduction. It may prevent premature elimination of red blood cells and contribute to membrane permeability changes induced following virus infection.
Gene References Into Functions
  1. This study demonstrates that inhibition of IAP represses inflammatory status via the nuclear factor-kappa B pathway in murine endometriosis lesions. PMID: 29105884
  2. Our findings support an intrinsic role of CD47 in ovarian cancer progression and immune evasion. PMID: 28380460
  3. Mice deficient in CD47 (CD47 Knockout) exhibited significantly reduced brain neutrophil infiltration at 24h, accompanied by upregulated VEGF expression in the peri-lesion cortex at 7 and 14 days. PMID: 27931776
  4. TSP1 significantly accelerates replicative senescence and associated cell cycle arrest in a CD47-dependent manner. PMID: 27607583
  5. CD47, TSP1, and to a lesser extent SIRPalpha facilitate exosome-mediated myeloid-derived suppressor cells chemotaxis and migration. PMID: 27728760
  6. In pulmonary hypertension, TSP1-CD47 is upregulated and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621
  7. Thrombospondin-1, via CD47, inhibits renal tubular epithelial cell recovery after ischemia-reperfusion injury through inhibition of proliferation and self-renewal. PMID: 27259369
  8. These findings have demonstrated how tumor cells inhibit innate sensing in dendritic cells and suggested that the CD47-SIRPalpha axis is critical for dendritic cell-driven antitumor immunity. PMID: 28801234
  9. This study indicates that CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis. PMID: 27283989
  10. The results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting the TSP-1/CD47 axis may represent a valuable therapeutic alternative for hindering melanoma spreading. PMID: 27349907
  11. Treg cells protect dopaminergic neurons against MPP+ neurotoxicity by a cell-to-cell contact mechanism involving CD47-SIRPA interaction and Rac1/Akt activation. PMID: 28268219
  12. CD47 deficient mice with vaccination demonstrated greater protective efficacy against lethal challenge. PMID: 27194758
  13. These results highlight an important role for CD47-SIRPalpha interactions in innate control of malaria and suggest novel targets for intervention. PMID: 27091932
  14. Atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule known to render malignant cells resistant to programmed cell removal, or 'efferocytosis'. PMID: 27437576
  15. Erythrocyte CD47 plays a key role in hematoma clearance after intracerebral hemorrhage. PMID: 26732568
  16. These data indicate that CD47 plays protective roles against disseminated candidiasis and alters pro-inflammatory and immunosuppressive pathways known to regulate innate and T cell immunity. PMID: 26010544
  17. CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production. PMID: 26095930
  18. The cell adhesion molecule CD47 participates in multiple phases of granule cell development, including proliferation, migration, and neurite differentiation. PMID: 25288019
  19. CD47 mediates signaling from the extracellular matrix, coordinating regulation of basal metabolism and cytoprotective responses to radiation injury. PMID: 26311851
  20. Collectively, these data revealed a novel role for CD47 in the development of obesity and its associated metabolic complications. PMID: 25747123
  21. NF KB-mediated CD47 upregulation promotes sorafenib resistance in treating hepatocellular carcinoma. PMID: 25902734
  22. Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitates apoptotic cell clearance by macrophages. PMID: 26085683
  23. Findings demonstrate that the TSP-1/CD47/SIRP-alpha signal axis is significant in the evolution of tumor cells within the microenvironment of immunotherapy, identifying thrombospondin-1 as a key signal. PMID: 25697354
  24. Thrombospondin-1 and CD47 signaling regulate the healing of thermal injury in mice. PMID: 24840925
  25. The microglial proinflammatory response to Abeta(1-42) protofibril is not dependent on CD47. PMID: 25451248
  26. CD47 expression in the microenvironment was sufficient to limit tumor radiosensitivity. PMID: 25297630
  27. CD47 plays a role in promoting left ventricular heart failure through CaKMII-mediated up-regulation of HDAC3. PMID: 24922625
  28. Polymorphism in the innate immune receptor SIRPalpha controls CD47 binding and autoimmunity in the nonobese diabetic mouse. PMID: 25305319
  29. Using a syngeneic mouse hepatocyte transplantation model, this study demonstrates that the absence of CD47 on donor cells alone can trigger recipient myeloid cell activation and graft loss. PMID: 23394628
  30. This study investigated the effect of Hsp70-peptide complex on the expression of CD172alpha and CD47 receptors in normal peritoneal macrophages (NMO). PMID: 24684700
  31. CD47 plays a pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID: 24726056
  32. 'Clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signaling. PMID: 24143245
  33. Thrombospondin-1 signaling through CD47 is the first identified endogenous inhibitor of H2S signaling and constitutes a novel mechanism that negatively regulates T cell activation. PMID: 23499828
  34. Data suggest that a lack of CD47 strongly impairs SIRPalpha-dependent osteoblast differentiation, deteriorates bone formation, and causes reduced formation of osteoclasts. PMID: 23990469
  35. Therefore, CD47 antagonists enable cell self-renewal and reprogramming by overcoming the negative regulation of c-Myc and other stem cell transcription factors. PMID: 23591719
  36. CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury. PMID: 22874555
  37. Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production. PMID: 23275336
  38. CD47 deficiency promotes nerve fiber growth from cultured ventral mesencephalic dopamine neurons. PMID: 23049778
  39. While polymorphonuclear neutrophil (PMN) transmigration is not delayed in CD47-deficient mice, fewer neutrophils are found in the intestine at the postacute/chronic stage of chronic colitis. PMID: 23203922
  40. CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice. PMID: 22870271
  41. Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1. PMID: 23087362
  42. Ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding with significant implications for the generation of robust humanized small animal models. PMID: 22535707
  43. Activation of parenchymal CD47 promotes renal ischemia-reperfusion injury. PMID: 22859854
  44. Engagement of endothelial CD47 by its ligands triggers outside-in signals in endothelium, facilitating leukocyte transendothelial migration at sites of inflammation. PMID: 22815286
  45. Data demonstrate that CD47(-/-) mice are refractory to experimental autoimmune encephalomyelitis (EAE). PMID: 22734047
  46. Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1. PMID: 22215724
  47. CD47(high) status on CD4 T cells identifies functional long-lived memory T cell progenitors. PMID: 22461697
  48. CD47 signaling is dispensable for oral tolerance induction, while the expression of CD47 by non-hematopoietic cells is required for intestinal IgA B-cell responses. PMID: 22070457
  49. This research provides a rational basis for targeting CD47-SIRPalpha interactions, potentially using antagonistic antibodies against human SIRPalpha, to enhance the clinical efficacy of cancer therapeutic antibodies. PMID: 22042861
  50. CD47 deletion improves functional recovery from spinal cord injury through increased vascular patency, improved functional locomotion, and greater white matter sparing. PMID: 21168495

Show More

Hide All

Database Links

KEGG: mmu:16423

UniGene: Mm.31752

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse CD47 and how does it compare to human CD47?

Mouse CD47, like its human counterpart, is an integral membrane protein belonging to the immunoglobulin superfamily. It consists of an extracellular domain (ECD) with a single Ig-like domain, five membrane-spanning regions with short intervening loops, and a cytoplasmic tail. Human CD47 comprises a 123 amino acid extracellular domain with similar structural organization . The mouse and human CD47 proteins share approximately 63% amino acid sequence identity in the N-terminal ECD region .

This structural homology is important for researchers working with mouse models, though the CD47-SIRPα interaction demonstrates species specificity that must be considered when translating findings between species. This species-specific interaction has significant implications for xenotransplantation studies and when evaluating therapeutic approaches targeting the CD47-SIRPα axis.

What are the primary signaling pathways associated with mouse CD47?

Mouse CD47 engages in several key signaling pathways:

Signaling PathwayBinding PartnersCellular EffectsResearch Applications
SIRPα pathwaySIRPα on macrophagesInhibition of phagocytosis through SHP-1/SHP-2 recruitmentCancer immunotherapy, tissue regeneration
Thrombospondin-1 pathwayThrombospondin-1Regulation of cell adhesion, migration, and angiogenesisVascular biology, wound healing
Integrins (α2β1, αvβ3)Various extracellular matrix proteinsModulation of cell adhesion and migrationDevelopmental biology, tissue engineering

The interaction between CD47 and SIRPα represents the canonical "don't eat me" signaling pathway, which prevents phagocytosis of CD47-expressing cells. This pathway has significant implications for immune evasion in cancer and plays crucial roles in normal tissue homeostasis . The interaction between CD47 and thrombospondin-1 influences various cellular processes including angiogenesis and cell death, making it relevant for vascular biology research.

How does mouse CD47 regulate normal tissue homeostasis?

Mouse CD47 contributes to tissue homeostasis through several mechanisms:

  • Self-recognition: CD47 serves as a "marker of self" that prevents clearance of healthy cells by phagocytes.

  • Mesenchymal progenitor regulation: CD47 promotes mesenchymal stem cell (MSC) proliferation, particularly during stress or injury states . In CD47-null mice, MSC colony expansion and proliferation are reduced, with decreased formation of large colonies (>100 ALP positive cells) compared to wild-type .

  • Vascular homeostasis: CD47 influences endothelial cell density and function. CD47-null mice exhibit increased endothelial cell density in peripheral callus regions during bone healing .

  • Tissue repair: CD47 regulates the early phases of injury response. In fracture models, CD47-null mice show delayed callus formation at day 10 post-fracture, with reductions in bone volume and bone volume fraction . This suggests CD47 plays a role in the early cellular responses to tissue damage.

These findings indicate that CD47 is not merely an immune checkpoint molecule but serves broader functions in tissue maintenance and repair processes.

What are the optimal methods for producing recombinant mouse CD47 for research applications?

Production of high-quality recombinant mouse CD47 typically follows these methodological approaches:

  • Expression system selection: Most researchers use mammalian expression systems (HEK293 or CHO cells) for mouse CD47 production to ensure proper post-translational modifications, especially glycosylation patterns that may be important for function.

  • Construct design considerations:

    • Full-length vs. extracellular domain only: For many applications, the extracellular domain fused to an Fc tag (similar to human CD47-Fc chimera) provides sufficient biological activity

    • Codon optimization for the expression system

    • Inclusion of appropriate purification tags (His, Fc, etc.)

  • Purification protocol:

    • Affinity chromatography (typically Protein A for Fc-tagged constructs)

    • Size exclusion chromatography to remove aggregates

    • Endotoxin removal steps for in vivo applications

  • Quality control assessments:

    • SDS-PAGE and Western blot for purity and identity verification

    • Functional binding assays to confirm interaction with SIRPα

    • Endotoxin testing for in vivo applications

For researchers requiring carrier-free preparations (without BSA or other carrier proteins), special attention should be paid to protein stability during storage, as carrier-free preparations may be less stable over time .

What are the critical considerations when designing CD47 knockout or knockdown experiments in mice?

When designing CD47 knockout or knockdown studies, researchers should consider:

  • Model selection:

    • Global knockout: Useful for understanding systemic effects but may confound tissue-specific functions

    • Conditional knockout: Preferred for tissue-specific studies to avoid developmental compensation

    • Inducible knockout: Valuable for temporal control, especially when studying acute vs. chronic effects

  • Sex-specific considerations:
    Two-way ANOVA analysis of CD47-null mice has revealed both interaction and sex-based effects in fracture healing models. Female mice show greater fibrous tissue content and percent cartilage regardless of genotype, with reductions in percent bone and marrow . Most phenotypic variation, particularly at early time points (day 10), appears to be primarily driven by genotype differences rather than sex .

  • Control selection:

    • Littermate controls are essential to minimize genetic background effects

    • Include both wild-type and heterozygous animals when possible

    • Control for potential off-target effects in CRISPR-generated models

  • Phenotypic assessment timeline:
    Studies show that CD47-null mice exhibit delayed fracture healing at day 10 post-injury, but these differences largely disappear by day 20 . This temporal dynamic highlights the importance of multiple assessment timepoints when characterizing CD47 knockout phenotypes.

  • Complementary approaches:

    • Pair genetic models with pharmacological inhibition

    • Consider rescue experiments to confirm phenotype specificity

    • Use cell-specific markers to identify affected cell populations

What are the recommended protocols for assessing CD47 expression in mouse tissues?

TechniqueApplicationsAdvantagesLimitationsSpecial Considerations
Flow cytometrySingle-cell expression analysisQuantitative, multiple markersRequires tissue dissociationUse non-competing antibody clones
ImmunohistochemistrySpatial distribution in intact tissuesPreserves tissue architectureSemi-quantitativeValidate antibodies on CD47-null tissue
Western blotTotal protein expressionDetects size variantsLoses spatial informationMultiple CD47 isoforms may be present
qRT-PCRTranscript levelsHighly sensitiveDoesn't reflect proteinDesign primers for all isoforms
RNA-seqTranscriptomic profilingComprehensive isoform analysisComplex data analysisCompare to proteomics data

For immunostaining approaches, researchers should be aware that CD47 antibody epitope accessibility may be affected by tissue fixation methods. For optimal results:

  • Use fresh frozen sections when possible for maximal epitope preservation

  • If using fixed tissues, validate antigen retrieval methods specifically for CD47

  • Include appropriate positive and negative controls (especially CD47-null tissues)

  • Consider dual staining with multiple CD47 antibodies recognizing different epitopes

How can mouse CD47 models be used to investigate therapeutic targeting strategies?

Mouse models provide valuable platforms for investigating CD47-targeting therapeutic approaches:

  • Antibody-based therapies:

    • Anti-CD47 blocking antibodies can be tested for efficacy in disrupting CD47-SIRPα interactions

    • Bispecific antibodies targeting both CD47 and tumor-specific antigens can be evaluated for increased specificity

    • Protease-activated antibody technologies like SGN-CD47M show promise for selective tumor targeting with reduced systemic toxicity

  • Genetic engineering approaches:

    • Humanized SIRPα mouse models using piggyBac, CRISPR/Cas9, or TALEN-mediated BAC transgenesis enable testing of human-specific anti-CD47 therapeutics

    • These models are particularly valuable since CD47-SIRPα interactions are species-specific

  • Combination therapy assessment:

    • Mouse models can evaluate synergistic effects between CD47 blockade and conventional checkpoint inhibitors

    • CD47 blockade in combination with chemotherapy or radiation can be studied for enhanced efficacy

  • Toxicity and biodistribution studies:

    • Mouse models allow for assessment of on-target/off-tumor effects

    • Tissue-specific conditional knockouts help distinguish therapeutic vs. adverse effects

Researchers should note that while mouse models are invaluable, the species-specific nature of CD47-SIRPα interactions means that humanized models may be required for translational studies of human-targeted therapeutics.

What are the molecular mechanisms through which CD47 influences mesenchymal progenitor cell function?

Recent research has revealed several mechanisms by which CD47 regulates mesenchymal progenitor cells:

  • Proliferative capacity regulation:
    CD47-null mesenchymal progenitor cells show reduced proliferation compared to wild-type cells. This is evidenced by:

    • Decreased formation of large colonies (>100 ALP-positive cells) in culture

    • Reduced MTT measurements at days 6 and 10 post-harvest, indicating lower metabolic activity

    • Decreased BrdU incorporation, particularly at day 1 post-passage

  • Contact inhibition modulation:
    CD47 appears to influence cell-cell contact regulation in mesenchymal progenitor cells, potentially through:

    • Interaction with integrin signaling pathways

    • Modulation of cell adhesion molecule expression

    • Regulation of mechanosensitive signaling cascades

  • Stress response mediation:
    CD47 appears particularly important during stress conditions:

    • No difference in bone marrow counts is observed prior to plating between WT and CD47-null mice

    • Differences in proliferation become apparent during culture or injury states

    • This suggests CD47 plays a key role in stress response pathways in mesenchymal progenitors

  • Differentiation pathway effects:
    CD47 influences the balance of differentiation pathways, as evidenced by:

    • Altered callus composition in CD47-null fracture models (increased fibrous tissue and cartilage, decreased bone and marrow)

    • Changes in the expression of lineage-specific markers

These mechanisms highlight CD47's complex role beyond immune evasion, positioning it as a key regulator of mesenchymal progenitor function during tissue repair and regeneration.

How does CD47 function differ between tumor and normal tissues in mouse models?

CD47 exhibits distinct functional profiles in tumor versus normal tissues in mouse models:

  • Expression level differences:

    • Tumors typically show elevated CD47 expression compared to corresponding normal tissues

    • This upregulation correlates with activation of several oncogenic pathways

    • In colorectal cancer models, CD47-high expression is associated with mutations in TP53, KMT2C, and CIC, while showing lower frequencies of KRAS mutation

  • Immune microenvironment interactions:

    • CD47 expression in tumors is associated with an immune-engaged tumor microenvironment

    • In CD47-high colorectal cancer subtypes, there are higher frequencies of CMS1 (17.9% vs 14.5%) and CMS4 (40.1% vs 26.8%) molecular subtypes

    • These subtypes are characterized by distinct immune infiltration patterns

  • Vascular effects:

    • CD47 disruption increases vascularization in non-bone tissues

    • In tumor contexts, this may influence tumor angiogenesis and delivery of therapeutics

    • CD47-null mice show higher density of EMCN+ and CD31+ endothelial cells in peripheral callus regions

  • Proliferative consequences:

    • While CD47 promotes normal mesenchymal progenitor proliferation, its role in tumor cells may differ

    • CD47 blockade can have direct antiproliferative effects on certain tumor types

    • The proliferative impact of CD47 targeting varies depending on tumor type and molecular context

Understanding these contextual differences is crucial for developing targeted therapeutic approaches that disrupt CD47's tumor-promoting functions while minimizing impact on normal tissue function.

What are common pitfalls in CD47 functional assays and how can they be addressed?

Researchers working with CD47 functional assays should be aware of these common challenges:

  • Species-specific interaction issues:

    • Human CD47 does not bind mouse SIRPα effectively and vice versa

    • Solution: Use species-matched proteins or validated cross-reactive reagents

    • Consider humanized SIRPα mouse models for translational studies

  • Inconsistent phagocytosis assay results:

    • Variability in macrophage activation status

    • Differences in target cell:macrophage ratios

    • Solution: Standardize macrophage sources and activation protocols

    • Include positive controls (CD47 blocking antibodies) and negative controls

  • Antibody epitope accessibility problems:

    • CD47 epitopes may be masked by interaction partners

    • Solution: Use multiple antibody clones targeting different epitopes

    • Consider mild fixation methods that preserve epitope accessibility

  • Background from Fc receptor binding:

    • When using CD47-Fc fusion proteins or antibodies

    • Solution: Include appropriate Fc blocking reagents

    • Use F(ab')2 fragments when possible for blocking experiments

  • Variability in CD47 knockout phenotypes:

    • Sex-dependent effects that influence experimental outcomes

    • Temporal dynamics that change with development or injury stage

    • Solution: Analyze males and females separately

    • Include multiple timepoints in healing or developmental studies

How can researchers resolve contradictory findings between in vitro and in vivo CD47 studies?

When faced with discrepancies between in vitro and in vivo CD47 research findings, consider these methodological approaches:

  • Context-dependent signaling analysis:

    • CD47 functions differently depending on microenvironmental factors

    • Approach: Systematically compare signaling pathway activation between in vitro cultures and tissue samples

    • Use phospho-specific antibodies to assess pathway activation status

  • Model complexity considerations:

    • In vitro models may lack critical cell-cell interactions present in vivo

    • Approach: Employ co-culture systems or organoids that better recapitulate tissue complexity

    • Consider ex vivo tissue slice cultures as intermediate models

  • Temporal dynamics evaluation:

    • In vivo phenotypes may be temporary or compensated over time

    • Approach: Conduct time-course studies both in vitro and in vivo

    • As observed in fracture healing models, CD47-null phenotypes at day 10 largely disappear by day 20

  • Genetic background influences:

    • Strain-specific modifiers may affect in vivo but not in vitro findings

    • Approach: Test multiple genetic backgrounds or use congenic strains

    • Consider F2 intercrosses to identify modifier loci

  • Experimental validation hierarchy:

    • Approach: Establish a systematic validation pipeline:

      1. Confirm antibody specificity on CD47-null tissues/cells

      2. Validate phenotypes with multiple knockout/knockdown approaches

      3. Perform rescue experiments to confirm specificity

      4. Evaluate phenotypes in multiple cellular/tissue contexts

How is CD47 involved in the bone repair process and what are the implications for regenerative medicine?

Recent research has revealed CD47's unexpected role in bone repair processes:

  • Temporal regulation of callus formation:

    • CD47-null mice exhibit delayed callus formation at day 10 post-fracture

    • μCT analysis shows reductions in bone volume and bone volume fraction in CD47-null mice

    • Interestingly, the bone formed in the absence of CD47 shows higher average tissue mineral density (TMD) at day 10

  • Cell-specific effects during repair:

    • Mesenchymal progenitor proliferation is reduced in CD47-null conditions

    • EdU incorporation studies show decreased cell proliferation in CD47-null fracture callus at day 7 post-fracture

    • Endothelial cell density increases in the peripheral callus region of CD47-null mice

  • Sex-specific considerations in bone repair:

    • Female mice show greater fibrous tissue content and percent cartilage regardless of CD47 status

    • Female mice exhibit reductions in percent bone and marrow during early repair

    • These sex-related differences largely equalize by day 20 post-fracture

  • Therapeutic implications:

    • Temporary CD47 blockade might enhance vascularization while allowing later stage proliferation

    • Sex-specific treatment approaches may be warranted based on differential responses

    • Targeting CD47 could potentially enhance endothelial cell contribution to tissue repair

These findings suggest complex and time-dependent roles for CD47 in tissue repair processes, with important implications for regenerative medicine applications targeting the CD47 pathway.

What are the latest findings regarding CD47's role in immunotherapy resistance mechanisms?

Emerging research highlights several mechanisms through which CD47 contributes to immunotherapy resistance:

  • Molecular resistance pathways:

    • CD47-high tumors show distinct mutation profiles, including higher frequencies of mutations in TP53, KMT2C, and CIC genes

    • CD47-high colorectal tumors exhibit molecular subtypes (CMS1 and CMS4) associated with distinct immune infiltration patterns

    • These molecular signatures may predict response to CD47-targeted therapies

  • Adaptive resistance mechanisms:

    • Following CD47 blockade, tumors may upregulate alternative "don't eat me" signals

    • CD24, PD-L1, and MHC-I have been implicated in compensatory pathways

    • These compensatory mechanisms suggest rational combination therapy approaches

  • Tumor microenvironment influences:

    • Hypoxia upregulates CD47 expression, potentially limiting efficacy in poorly vascularized tumors

    • Myeloid composition of the tumor microenvironment affects response to CD47 blockade

    • Tumor-associated macrophage polarization status impacts phagocytic capacity following CD47 blockade

  • Novel targeting strategies:

    • Protease-activated antibody technologies like SGN-CD47M enable selective tumor targeting

    • Bispecific antibodies targeting CD47 and tumor-specific antigens show enhanced specificity

    • These approaches may overcome limitations of first-generation CD47-targeting strategies

Understanding these resistance mechanisms is crucial for developing effective combination strategies and identifying biomarkers that predict response to CD47-targeted therapies.

How does CD47 interact with the damage-associated molecular pattern (DAMP) signaling pathway in tissue repair?

Recent findings suggest important interactions between CD47 and DAMP signaling pathways:

  • CD47 and DAMP expression correlation:

    • In colorectal cancer studies, CD47 expression levels correlate with DAMPs signature scores

    • This signature includes CALR, HMGB1, ANXA1, HSPAA1, HSPA1A, and CXCL10

    • The correlation suggests functional interaction between CD47 signaling and DAMP pathways

  • Mechanistic interactions:

    • CD47 may regulate the release of DAMPs following cellular stress or damage

    • Alternatively, DAMPs may influence CD47 expression or signaling

    • These interactions appear particularly relevant during tissue injury responses

  • Tissue repair implications:

    • During fracture healing, CD47 disruption affects early cellular responses

    • This may involve altered DAMP signaling that influences recruitment of repair-associated cells

    • The temporal dynamics of healing in CD47-null mice suggest early DAMP-mediated effects

  • Therapeutic targeting potential:

    • Modulating both CD47 and DAMP pathways might enhance tissue repair

    • Timing of interventions would be critical given the temporal dynamics observed in repair processes

    • Combined biomarkers of CD47 and DAMP pathway activation might predict repair outcomes

Further research is needed to fully elucidate the molecular mechanisms connecting CD47 and DAMP signaling pathways, but these interactions represent promising targets for enhancing tissue repair processes.

What are the most promising translational applications of mouse CD47 research?

Mouse CD47 research has revealed several promising translational applications:

  • Cancer immunotherapy optimization:

    • Development of next-generation CD47-targeting approaches with improved specificity

    • Identification of biomarkers predicting response to CD47-targeted therapies

    • Rational combination strategies based on molecular subtypes and resistance mechanisms

  • Regenerative medicine applications:

    • Temporary CD47 blockade to enhance vascularization during tissue repair

    • Stage-specific CD47 modulation to optimize healing processes

    • Sex-specific treatment approaches based on differential responses to CD47 disruption

  • Autoimmune disease interventions:

    • CD47 agonists to reduce inappropriate phagocytosis in autoimmune conditions

    • Targeting CD47-thrombospondin interactions to modulate inflammatory responses

    • Cell-specific delivery strategies to limit off-target effects

  • Xenotransplantation advances:

    • Genetic engineering of donor tissues to express human CD47

    • This approach could help overcome species barriers in xenotransplantation

    • Humanized CD47/SIRPα mouse models provide valuable platforms for testing these approaches

These translational applications highlight the diverse potential of CD47-targeted interventions across multiple disease contexts and therapeutic modalities.

What key knowledge gaps remain in our understanding of mouse CD47 biology?

Despite significant advances, several important knowledge gaps remain in mouse CD47 biology:

  • Isoform-specific functions:

    • The functional significance of CD47 splice variants remains poorly understood

    • Cell type-specific expression patterns of different isoforms need further characterization

    • Potential differences in signaling pathway activation between isoforms require investigation

  • Non-canonical signaling pathways:

    • Beyond SIRPα and thrombospondin-1, CD47 likely engages additional binding partners

    • The complete CD47 interactome in different tissues and cell types remains to be fully mapped

    • Context-dependent signaling outcomes need systematic characterization

  • Developmental roles:

    • CD47's functions during embryonic and postnatal development are incompletely understood

    • Potential compensation mechanisms in developmental contexts require further study

    • Stage-specific requirements for CD47 signaling need investigation

  • Metabolic influences:

    • How CD47 signaling interfaces with cellular metabolism remains largely unexplored

    • Potential metabolic differences in CD47-null tissues may contribute to observed phenotypes

    • Metabolomic profiling of CD47-deficient models could reveal new functional insights

Addressing these knowledge gaps will require integrative approaches combining genetic models, systems biology, and advanced imaging techniques to fully elucidate CD47's multifaceted biological roles.

What technological advances will drive the next phase of CD47 research?

Several emerging technologies are poised to advance CD47 research:

  • Single-cell multi-omics approaches:

    • Single-cell RNA/ATAC-seq to map CD47 expression and regulation at cellular resolution

    • Spatial transcriptomics to understand CD47 expression in tissue microenvironmental contexts

    • These approaches will help resolve cell type-specific CD47 functions in complex tissues

  • Advanced protein interaction mapping:

    • Proximity labeling techniques (BioID, APEX) to map the CD47 interactome in living cells

    • Hydrogen-deuterium exchange mass spectrometry to characterize dynamic interaction interfaces

    • These methods will help identify novel CD47 binding partners and signaling connections

  • Intravital imaging advances:

    • Multiphoton microscopy with genetically encoded sensors to visualize CD47 signaling in vivo

    • Light-sheet microscopy for 3D visualization of CD47-expressing cells during tissue repair

    • These imaging approaches will help resolve the temporal and spatial dynamics of CD47 function

  • CRISPR-based functional genomics:

    • Genome-wide CRISPR screens to identify synthetic lethal interactions with CD47

    • CRISPRi/a approaches for precise modulation of CD47 expression

    • CRISPR base editing for introduction of specific CD47 mutations

    • These genomic tools will enable more precise dissection of CD47 function

  • Computational modeling approaches:

    • Systems biology models integrating CD47 signaling networks

    • Machine learning to predict CD47 pathway activation from multi-omics data

    • These computational approaches will help integrate diverse data types and generate testable hypotheses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.