Recombinant Mouse Leukotriene-B (4) omega-hydroxylase 2 (Cyp4f3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
Cyp4f3; Cyp4f18; Cytochrome P450 4F3; CYPIVF3; Leukotriene-B(4 omega-1/omega-2 hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cyp4f3
Target Protein Sequence
MSQLSMSWMGLGHTAASPWLLLLLAGASCLLAYILTPIYGVFENSLRLRCFPQPPKRNWI LGHLGLIQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKPVVLAPALVAPK DTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFNDSTNIMHAKWQR LASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSTLVARRHQRLL LHVDLFYYLTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFID VLLLSKDEHGKALSDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRE LLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPDGRVIPKGVIS RISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKV ALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLKVEPLSAGAQ
Uniprot No.

Target Background

Function

Recombinant Mouse Leukotriene-B4 omega-hydroxylase 2 (CYP4F3) is a cytochrome P450 monooxygenase that metabolizes the pro-inflammatory lipid mediator leukotriene B4 (LTB4). It hydroxylates LTB4 at the omega-1 and omega-2 positions, leading to LTB4 inactivation. This inactivation is considered crucial for resolving inflammation. The mechanism involves molecular oxygen; one oxygen atom is incorporated into the substrate, while the second is reduced to water using two electrons provided by NADPH via cytochrome P450 reductase (CPR).

Gene References Into Functions
  1. CYP4F18-deficient neutrophils demonstrate increased chemotaxis to complement component C5a. PMID: 26613087
  2. CYP4F18 is essential for omega oxidation of LTB4 in neutrophils and is not functionally compensated by other CYP enzymes. PMID: 24632148
  3. CYP4F18 plays a critical role in regulating LTB4 metabolism. PMID: 16380383
  4. Cyp4f18 mRNA levels increase during the development of allergic lung inflammation. PMID: 17081494
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Tissue Specificity
Highest level in polymorphonuclear leukocytes and dendritic cells. Detectable in lymph nodes, spleen, bone marrow and peripheral blood. Highly expressed in ovary. Very low level in liver, kidney, and smooth muscle. Expressed in neutrophils (at protein lev

Q&A

What is Mouse Leukotriene-B(4) Omega-Hydroxylase 2 (Cyp4f3) and what is its primary function?

Cyp4f3 (also known as Cytochrome P450 4F3, CYPIVF3, or Leukotriene-B(4) omega-1/omega-2 hydroxylase) is a member of the cytochrome P450 enzyme family. The full-length mouse protein consists of 524 amino acids and plays a critical role in eicosanoid metabolism. Its primary function is the ω-hydroxylation of leukotriene B4 (LTB4), a potent pro-inflammatory mediator, converting it to the less active metabolite 20-hydroxy-leukotriene B4 (20OH-LTB4) .

The protein exists in two splice variants with distinct tissue distributions and substrate specificities:

  • CYP4F3A: Predominantly expressed in leukocytes with high affinity for LTB4

  • CYP4F3B: Mainly expressed in liver and kidney with approximately 30-fold lower affinity for LTB4, preferentially metabolizing arachidonic acid (AA) and ω3 polyunsaturated fatty acids (PUFAs)

How should recombinant Cyp4f3 be handled and stored for optimal stability?

For optimal stability and activity of recombinant Cyp4f3, the following handling and storage protocols are recommended:

Storage ConditionRecommendation
Long-term storage-20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles
ReconstitutionReconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Working aliquotsStore at 4°C for up to one week
CryopreservationAdd glycerol to 5-50% final concentration before freezing

It's important to note that repeated freezing and thawing cycles significantly reduce protein stability and activity. Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. After reconstitution, aliquoting with glycerol addition (recommended final concentration 50%) is advised for long-term storage .

What experimental methods are used to assess Cyp4f3 enzymatic activity?

Assessment of Cyp4f3 enzymatic activity typically involves measuring the conversion of LTB4 to 20-OH-LTB4. Several methodological approaches can be employed:

  • Capillary Electrophoresis Analysis: This technique allows separation and quantification of Cyp4f3 metabolites. The method utilizes a P/ACE MDQ capillary electrophoresis system with 32 KaratTM software for instrument control and data analysis .

  • Co-immunoprecipitation Assays: These can evaluate the interaction between Cyp4f3 and its electron donors such as POR (P450 oxidoreductase) and Cytb5 (Cytochrome b5), which are essential for its catalytic function .

  • Cellular Assays:

    • Transfection of cells (e.g., HEK293 cells) with CYP4F3A wild-type or mutant plasmids

    • Cell harvesting and homogenization in medium containing 0.25 M sucrose, 5 mM MOPS (pH 7.2), and 1 mM EDTA with protease inhibitors

    • Homogenization using a cold steel grinder followed by centrifugation

    • Analysis of metabolite production via chromatographic or spectroscopic methods

  • LC-MS/MS Analysis: For precise quantification of LTB4 and its metabolites in biological samples, including plasma and cellular extracts.

How does the electron transfer mechanism function in Cyp4f3 enzymatic activity?

The enzymatic activity of Cyp4f3, like other cytochrome P450 enzymes, relies on a sophisticated electron transfer mechanism:

  • Cofactor Requirement: Cyp4f3 requires NADPH as an electron source and electron transfer partners for its oxidase activity.

  • Conformational Changes: When LTB4 binds to the substrate-binding site of Cyp4F3A, it induces a conformational change that facilitates electron transfer from electron transfer partners to the heme group in the active site.

  • Electron Transfer Components:

    • POR (P450 Oxidoreductase): Consists of four domains:

      • FMN-binding domain (interacts with P450 enzymes)

      • Connecting domain

      • FAD-binding domain

      • NADPH-binding domain

    • POR receives two electrons from NADPH and transfers them via the FAD domain to its FMN domain .

  • Complex Formation: POR and Cyp4f3 form complexes via electrostatic interactions, which facilitates electron transfer from the FMN domain of POR to the heme group of Cyp4f3. Conserved patches of electrostatic and hydrophobic amino acids specific to Cyp4f3 contribute to the binding selectivity with POR .

  • Role of Cytochrome b5 (Cytb5): May provide the second electron in the P450 catalytic cycle, enhancing the catalytic efficiency of certain P450-mediated reactions.

This electron transfer pathway is critical for the ω-hydroxylation function of Cyp4f3, and disruptions in this mechanism can significantly impact enzyme activity, as observed in disease-associated variants.

What is the impact of missense mutations on Cyp4f3 activity and LTB4 metabolism?

Missense mutations in Cyp4f3 can significantly affect its enzymatic activity and consequently alter LTB4 metabolism, leading to various pathophysiological conditions. Research has identified specific mutations with demonstrable functional consequences:

  • c.C1123 > G;p.L375V Mutation:

    • Severely impairs Cyp4f3 activity by approximately 50% (P < 0.0001)

    • Leads to reduced metabolization of pro-inflammatory LTB4

    • Results in significantly increased systemic LTB4 levels (1034.0 ± 75.9 pg/mL) compared to healthy subjects (305.6 ± 57.0 pg/mL, P < 0.001)

  • Immunological Consequences:

    • Altered LTB4 levels associated with increased total CD19+ CD27- naive B cells (25%)

    • Decreased total CD19+ CD27+ IgD- switched memory B cells (19%)

  • Structural Analysis of Mutation Effects:

    • The mutant CYP4F3 protein remains stable, and binding with electron donors (POR and Cytb5) is unaffected (P > 0.9 for both co-immunoprecipitation experiments)

    • In silico modeling suggests that the loss of catalytic activity in mutant CYP4F3 results from disruption of an α-helix crucial for electron shuffling between electron carriers and CYP4F3

  • Therapeutic Implications:

    • Zileuton inhibits ex vivo LTB4 production in patient's whole blood to 2% of control (P < 0.0001)

    • Montelukast and fluticasone show no significant effect (99% and 114% of control, respectively)

These findings indicate that specific mutations in the catalytic domain of Cyp4f3 can lead to dysregulated LTB4 metabolism, contributing to inflammatory conditions and potentially affecting immune system function.

How is Cyp4f3 involved in cancer progression, particularly in colorectal liver metastasis?

Recent research has identified a significant role for Cyp4f3 in cancer progression, particularly in colorectal cancer (CRC) and colorectal liver metastasis (CRLM):

  • Expression Patterns:

    • CYP4F3 is highly expressed in both CRC and CRLM tissues

    • Expression levels show a negative correlation with CRLM prognosis, suggesting potential value as a prognostic biomarker

  • Involvement in Neutrophil Extracellular Traps (NETs):

    • CYP4F3 has been identified as one of seven differentially expressed genes (DEGs) associated with neutrophil extracellular traps

    • Other identified genes in this signature include ATG7, CTSG, F3, IL1B, PDE4B, and TNF

    • These genes collectively form a prognostic signature for CRLM

  • Prognostic Value:

    • CYP4F3 expression can be incorporated into nomograms for predicting:

      • The occurrence of CRLM in CRC patients

      • Prognosis of patients with established CRLM

    • Higher expression levels correlate with poorer outcomes, identifying CYP4F3 as a risk factor

  • Therapeutic Implications:

    • Based on its role in CRLM progression, CYP4F3 has been suggested as a potential therapeutic target

    • Modulation of CYP4F3 activity might influence neutrophil extracellular trap formation and potentially impact cancer metastasis

These findings highlight the emerging role of Cyp4f3 beyond its established function in LTB4 metabolism, suggesting its involvement in complex cancer-related processes, particularly in the context of colorectal cancer metastasis to the liver.

How can in silico modeling be used to study Cyp4f3 structure and function?

In silico modeling provides valuable insights into Cyp4f3 structure, function, and interactions with other proteins and substrates. Several computational approaches have been successfully applied:

Through these computational approaches, researchers can gain detailed insights into how mutations affect Cyp4f3 structure and function, predict interaction with substrates and electron transfer partners, and identify potential targets for therapeutic intervention.

What are the optimal conditions for expressing recombinant mouse Cyp4f3 in E. coli?

Successful expression of recombinant mouse Cyp4f3 in E. coli requires careful optimization of several parameters:

ParameterRecommended Conditions
Expression VectorpET or pGEX systems with N-terminal His tag for purification
E. coli StrainBL21(DE3) or Rosetta(DE3) for rare codon optimization
Induction0.1-1.0 mM IPTG at OD600 of 0.6-0.8
Temperature16-18°C post-induction (to minimize inclusion body formation)
Duration16-20 hours for optimal protein yield
MediaEnriched media (e.g., TB or 2xYT) supplemented with δ-aminolevulinic acid (precursor for heme synthesis)

For optimal protein quality, consider:

  • Co-expression with chaperones to improve proper folding

  • Addition of heme precursors to enhance incorporation into the protein structure

  • Reduced induction temperature to minimize inclusion body formation

  • Gentle lysis conditions to preserve protein activity

After expression, purification typically involves immobilized metal affinity chromatography (IMAC) using the N-terminal His tag, followed by size exclusion chromatography for higher purity samples .

How can researchers validate the functional activity of purified recombinant Cyp4f3?

Validating the functional activity of purified recombinant Cyp4f3 is essential to ensure the protein is correctly folded and enzymatically active. Several complementary approaches can be employed:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy to confirm proper heme incorporation (characteristic Soret band at ~450 nm when reduced and bound to carbon monoxide)

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Substrate Conversion Assay:

    • Incubation of purified Cyp4f3 with LTB4 in the presence of NADPH and electron transfer partners (POR and Cytb5)

    • Quantification of 20-OH-LTB4 formation using liquid chromatography-mass spectrometry (LC-MS/MS)

    • Comparison of activity to established standards or previous literature values

  • Binding Affinity Determination:

    • Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure binding affinity for LTB4

    • Determination of Km and Vmax values through enzyme kinetics experiments

  • Electron Transfer Partner Interactions:

    • Co-immunoprecipitation assays to confirm interaction with POR and Cytb5

    • Biolayer interferometry or SPR to measure binding kinetics with electron transfer partners

  • Inhibition Studies:

    • Confirmation of expected inhibition patterns with known inhibitors such as zileuton

    • Determination of IC50 values to compare with published literature

These validation approaches provide comprehensive assessment of both structural integrity and catalytic function of the recombinant Cyp4f3 protein.

How do alterations in Cyp4f3 function contribute to inflammatory diseases?

Alterations in Cyp4f3 function can significantly impact inflammatory processes through dysregulation of LTB4 metabolism, contributing to various inflammatory conditions:

  • Mechanism of LTB4 Dysregulation:

    • Reduced Cyp4f3 activity leads to decreased ω-hydroxylation of LTB4

    • Impaired conversion of LTB4 to its less active metabolite (20-OH-LTB4)

    • Resulting elevated LTB4 levels promote sustained pro-inflammatory signaling

  • Immunological Consequences:

    • Alterations in B cell populations with increased naive B cells (CD19+ CD27-)

    • Decreased switched memory B cells (CD19+ CD27+ IgD-)

    • These changes suggest a shift toward a more naive adaptive immune response

  • Clinical Manifestations:

    • Patients with CYP4F3 mutations may present with:

      • Muscle weakness

      • Immune dysregulation

      • Features of immune exhaustion

      • Chronic inflammatory conditions

  • Therapeutic Implications:

    • LTB4 pathway inhibitors such as zileuton show promise in blocking LTB4 production

    • Different classes of anti-inflammatory drugs show varying efficacy:

      • Zileuton effectively reduces LTB4 production to 2% of control levels

      • Montelukast and fluticasone show minimal effects on LTB4 levels

Understanding these mechanisms provides insights into potential therapeutic strategies for inflammatory conditions associated with Cyp4f3 dysfunction, with targeted inhibition of the LTB4 pathway representing a promising approach.

What is the potential of Cyp4f3 as a therapeutic target in colorectal liver metastasis?

Recent research has identified Cyp4f3 as a promising therapeutic target in colorectal liver metastasis (CRLM), with several lines of evidence supporting its potential clinical relevance:

  • Expression Pattern and Prognostic Value:

    • CYP4F3 is highly expressed in both colorectal cancer (CRC) and CRLM tissues

    • High expression levels correlate with poorer prognosis in CRLM patients

    • Expression analysis can contribute to nomograms predicting CRLM occurrence and prognosis

  • Association with Neutrophil Extracellular Traps (NETs):

    • CYP4F3 is one of seven differentially expressed genes (DEGs) associated with neutrophil extracellular traps

    • NETs play pivotal roles in cancer progression and metastasis

    • CYP4F3 may influence NET formation or function in the context of cancer

  • Target Validation Approaches:

    • Immunohistochemical staining confirms differential expression in clinical samples

    • Gene expression analysis across multiple datasets supports its role in CRLM

    • Functional studies can further validate mechanisms of action

  • Potential Therapeutic Strategies:

    • Small molecule inhibitors targeting CYP4F3 enzymatic activity

    • RNA interference approaches to reduce CYP4F3 expression

    • Immunotherapeutic approaches targeting cells with high CYP4F3 expression

    • Combination therapies addressing both CYP4F3 and other NET-related factors

  • Challenges and Considerations:

    • Potential off-target effects due to the role of CYP4F3 in normal physiological processes

    • Tissue-specific delivery systems may be required to minimize systemic effects

    • Biomarker development to identify patients most likely to benefit from CYP4F3-targeted therapies

These findings highlight the potential of Cyp4f3 as a novel therapeutic target in CRLM, with implications for both prognostic assessment and treatment development.

What are the most promising research avenues for understanding Cyp4f3 biology?

Several promising research avenues are emerging for deeper understanding of Cyp4f3 biology:

  • Structural Studies:

    • High-resolution crystal or cryo-EM structures of mouse and human CYP4F3 variants

    • Complex structures with electron transfer partners and substrates

    • Dynamics of structural changes during catalytic cycles

  • Systems Biology Approaches:

    • Multi-omics integration to understand Cyp4f3's role in broader metabolic and signaling networks

    • Single-cell analysis of Cyp4f3 expression and function in heterogeneous tissues

    • Network analysis of Cyp4f3's interaction with inflammation and cancer pathways

  • Advanced In Vivo Models:

    • Development of tissue-specific and inducible Cyp4f3 knockout models

    • Humanized mouse models expressing human CYP4F3 variants

    • Patient-derived xenograft models to study CYP4F3 in cancer progression

  • Therapeutic Development:

    • Structure-based design of selective CYP4F3 modulators

    • Development of tissue-targeted delivery systems for CYP4F3-modulating compounds

    • Combination approaches targeting CYP4F3 and related inflammatory pathways

  • Clinical Translational Research:

    • Biomarker studies correlating CYP4F3 variants with disease progression

    • Pharmacogenomic analyses of response to LTB4 pathway inhibitors

    • Integration of CYP4F3 status in precision medicine approaches

These research directions promise to enhance our understanding of Cyp4f3's multifaceted roles in normal physiology and disease pathogenesis, potentially leading to novel diagnostic and therapeutic strategies.

How might CRISPR-Cas9 technology be utilized to study Cyp4f3 function?

CRISPR-Cas9 technology offers powerful approaches for investigating Cyp4f3 function across multiple experimental systems:

  • Gene Editing Applications:

    • Generation of precise point mutations (e.g., L375V) to study specific functional defects

    • Creation of splice variant-specific knockouts to distinguish CYP4F3A vs. CYP4F3B functions

    • Introduction of reporter tags (e.g., fluorescent proteins) for live-cell imaging of Cyp4f3 localization and dynamics

  • Transcriptional Modulation:

    • CRISPRa (activation) to upregulate Cyp4f3 expression in specific cell types

    • CRISPRi (interference) to achieve tissue-specific or inducible Cyp4f3 knockdown

    • Multiplexed approaches to simultaneously modulate Cyp4f3 and interacting genes

  • High-Throughput Functional Genomics:

    • CRISPR screens to identify genes that synthetically interact with Cyp4f3

    • Saturating mutagenesis to comprehensively map structure-function relationships

    • Pooled screens in disease models to identify contexts where Cyp4f3 function is critical

  • In Vivo Applications:

    • Development of tissue-specific Cyp4f3 knockout or knock-in mouse models

    • Somatic gene editing in adult animals to avoid developmental compensation

    • Humanized mouse models expressing human CYP4F3 variants

  • Therapeutic Proof-of-Concept:

    • Correction of disease-associated Cyp4f3 mutations in patient-derived cells

    • Testing of potential off-target effects of Cyp4f3-targeting therapeutics

    • Development of Cyp4f3-targeting gene therapy approaches

These CRISPR-based approaches provide unprecedented precision in manipulating Cyp4f3 function, enabling detailed investigation of its role in health and disease, and potentially supporting the development of novel therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.