Recombinant Mouse Leukotriene B4 receptor 2 (Ltb4r2)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Mouse Leukotriene B4 Receptor 2 (Ltb4r2) is a synthetic version of the endogenous BLT2 receptor, a G protein-coupled receptor (GPCR) encoded by the Ltbr2 gene. It binds low-affinity ligands such as leukotriene B4 (LTB4) and high-affinity ligands like 12-hydroxyheptadecatrienoic acid (12-HHT), mediating diverse cellular responses in inflammation, immune regulation, and cancer .

FeatureDetail
GeneLtbr2 (mouse); LTB4R2 (human)
Protein Structure45% amino acid identity with BLT1; 7-transmembrane domains
SynonymsBLT2, BLTR2, JULF2, KPG_004, LTB4-R2
FunctionChemotaxis, calcium signaling, reactive oxygen species (ROS) production

Mechanism of Action

Ltb4r2 activates G proteins (Gαi and Gαq) to trigger downstream pathways:

  • Calcium mobilization via phosphatidylinositol-calcium second messengers .

  • ERK, Akt, JNK, and NF-κB activation, regulating inflammation and survival .

  • NADPH oxidase (NOX) activation, generating ROS that modulate NF-κB transcription .

Ligand Affinity

LigandAffinity (BLT2)Function
LTB4Low (μM range)Chemotaxis, inflammation
12-HHTHigh (nM range)Barrier maintenance, angiogenesis
12(S)-HPETEModeratePro-inflammatory signaling

Tissue Distribution and Expression

  • Mouse: Limited to small intestine, skin, colon, and spleen .

  • Human: Widespread expression in spleen, liver, lung, colon, and placenta .

  • Immune Cells: Macrophages, peritoneal macrophages, and BMDMs .

Inflammation and Immunity

  • Allergic Responses: BLT2 knockout mice show reduced IL-13 production and eosinophilic inflammation in ovalbumin-induced asthma models .

  • Colitis: Ltbr2−/− mice exhibit severe colitis with elevated pro-inflammatory cytokines (IFN-γ, IL-6) and impaired epithelial barrier integrity .

  • Arthritis: BLT2 deficiency does not alter joint inflammation in collagen-induced arthritis, suggesting BLT1 dominance in this model .

Cancer and Angiogenesis

  • Liver Cancer: LTB4R2 promotes YAP1 and β-catenin activation, driving hepatocellular carcinoma (HCC) growth via the Wnt pathway .

  • Angiogenesis: BLT2 overexpression enhances VEGF-induced neovascularization, critical for tumor metastasis .

Barrier Function

  • Lung: Protects against pneumolysin-induced injury by maintaining tight junction proteins (e.g., claudin-4) .

  • Skin: Accelerates wound healing via 12-HHT signaling .

Recombinant Protein Applications

Recombinant Ltb4r2 is produced via:

  • E. coli: For structural studies (e.g., His-tagged) .

  • Mammalian Cells: HEK293 or CHO cells for functional assays (e.g., Myc-DDK-tagged) .

VendorFormatTagApplication
Creative BioMartE. coli, MammalianHis, FcELISA, binding assays
OrigenepCMV6-EntryMyc-DDKTransfection, Western blotting
AbbexaLyophilizedN/AELISA quantification

Detection and Quantification

ELISA Kits (e.g., Abbexa) measure Ltb4r2 levels in tissues or lysates:

ParameterDetail
Detection Range0.156–10 ng/ml
Sample TypesTissue homogenates, cell lysates
SensitivityQuantitative colorimetric detection

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, keep working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ltb4r2; Blt2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; Leukotriene B4 receptor BLT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATL VLHLALADGAVLLLTPLFVAFLSQEAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRC LAVTRPFLAPRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGGRVCQLCHPSPVHAAA HLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG PRFLTRLFEGSGEARGGSRSREGTMELRTTPKLKVMGQGRGNGDPGGGDGGKTEKDSQEW
Uniprot No.

Target Background

Function
Leukotriene B4 receptor 2 (BLT2) is a low-affinity receptor for leukotrienes, including leukotriene B4. It mediates chemotaxis of granulocytes and macrophages. The response is triggered through G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions

Relevant Research Findings:

  1. FABP4 regulates the expression of BLT1R and its downstream signaling by controlling oxidative stress in macrophages PMID: 28546450
  2. This study demonstrates that LTB4 promotes macrophage phagocytosis of bacteria via BLT1, and that BLT2 can fulfill this role in the absence of BL PMID: 28053185
  3. The data reveal that the two leukotriene B4 receptors play opposing roles in the sensitization of peripheral sensory neurons, forming a self-restricting system. PMID: 28242764
  4. These results demonstrate that 12-HHT/BLT2 enhances epithelial barrier function by increasing CLDN4 expression via the Galphai protein-p38 MAPK pathway. PMID: 26527063
  5. Data indicate that leukotriene B4 receptor 2 protein BLT2-deficient mice exhibited impaired re-epithelialization and delayed wound closure after skin punching. PMID: 24821912
  6. Findings suggest that BLT2 has a protective role in allergic airway inflammation, and diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma. PMID: 23603839
  7. Selective inhibition of the BLT2 receptor in mice reduces the release of vascular reactive oxygen species and improves endothelial function in mice PMID: 21755457
  8. Results point to a direct anti-inflammatory role of BLT2 that is distinct from the proinflammatory roles of BLT1. PMID: 20667973
  9. Our findings suggest that the BLT2-Nox1-reactive oxygen species cascade is a previously unrecognized mediatory signaling mechanism for Th2 cytokine production in Ag-stimulated BMMCs PMID: 20952677
  10. BLT2-deficient mice develop normally; analysis of immune cells shows that disruption of BLT2 does not alter BLT1 expression or function. PMID: 20656922
  11. BLT2 plays a crucial mediatory role in the pathogenesis of asthma, acting through a "reactive oxygen species-NF-kappaB"-linked inflammatory signaling pathway. PMID: 19448154
  12. The 360 amino acid sequence was determined and aligned with the human sequence. PMID: 12895595
  13. BLT2 is a leukotriene B4 receptor with a role in ERK activation and cell migration of primary mouse keratinocytes. PMID: 15866883
  14. This research demonstrates the expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells, and a regulatory role for stem cell factor in their expression. PMID: 16920986
  15. 12-HHT is a natural lipid agonist of BLT2 in vivo and induces chemotaxis of mast cells. PMID: 18378794
  16. The BLT2 receptor is involved in 12(S)-lipoxygenase-product-induced scratching in ICR mice. PMID: 18536755
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Leukotriene B4 Receptor 2 (Ltb4r2) and what are its primary functions?

Leukotriene B4 Receptor 2 (BLT2) is a G-protein-coupled receptor (GPCR) that functions as a low-affinity receptor for several pro-inflammatory metabolites, including leukotriene B4 and eicosanoids such as 12-HETE, 12(S)-HPETE, and 15(S)-HETE . Research indicates that BLT2 plays crucial roles in inflammation and immune response, particularly in mediating macrophage migration during inflammatory conditions .

Unlike BLT1 (the high-affinity LTB4 receptor), BLT2 has broader ligand specificity and is expressed in various tissues including liver, spleen, adipose tissue, and immune cells such as bone marrow-derived macrophages (BMDMs) and peritoneal macrophages . Recent studies have also identified BLT2 as a contributor to KRAS-driven lung cancer, suggesting its involvement in oncogenic pathways .

Where is Ltb4r2 predominantly expressed in mice?

Mouse Ltb4r2 shows tissue-specific expression patterns that help explain its biological functions. Expression analysis through quantitative reverse transcription-PCR (qRT-PCR) has revealed:

Tissue/Cell TypeRelative Ltb4r2 Expression
LiverHigh
SpleenHigh
Adipose tissueModerate
Bone marrow-derived macrophagesHigh
Peritoneal macrophagesHigh
Pancreatic isletsLow to undetectable

This expression profile suggests that BLT2 plays significant roles in inflammatory responses within these tissues, particularly in macrophage-rich environments . Interestingly, the minimal expression in pancreatic islets indicates that BLT2 may not directly influence insulin secretion, which is consistent with observations that Ltb4r2-knockout mice exhibit normal glucose tolerance .

How does Ltb4r2 contribute to KRAS-driven lung cancer development?

Ltb4r2 (BLT2) has been identified as a significant contributor to KRAS-driven lung cancer development through several mechanisms:

  • Elevated expression: BLT2 expression levels and its ligand-producing enzymes (5-LOX, 12-LOX) are significantly increased in the presence of mutant KRAS .

  • Promotion of cell proliferation: Inhibition of BLT2 or its upstream enzymes (5-LOX, 12-LOX) attenuates KRAS-driven lung cell proliferation .

  • Regulation of inflammatory mediators: BLT2 drives the production of interleukin-6 (IL-6), a principal pro-inflammatory mediator implicated in lung cancer development .

  • In vivo evidence: Studies using transgenic mice with lung-specific expression of mutant KRAS (Kras G12D) demonstrated that BLT2 inhibition decreases both IL-6 production and tumor formation .

  • Confirmation in Kras G12D/BLT2-KO mice: Double-mutant mice showed significantly suppressed IL-6 production and lung tumor formation, further supporting BLT2's role in KRAS-driven tumorigenesis .

  • Clinical relevance: High BLT2 expression has been observed in tissue samples from patients with KrasG12D-expressing lung adenocarcinoma, supporting its contributory role in human lung cancer .

These findings collectively identify BLT2 as a potential therapeutic target for KRAS-driven lung cancer, which has traditionally been difficult to treat due to KRAS's "undruggable" structure .

What is the role of Ltb4r2 in inflammatory processes and macrophage function?

BLT2 plays a crucial role in inflammatory processes primarily by mediating macrophage migration:

  • Macrophage migration regulation: Transcriptomic analysis of Ltb4r2-/- macrophages revealed significant alterations in pathways related to macrophage chemotaxis and migration, particularly under pro-inflammatory conditions .

  • Downstream mediators: Genes that facilitate macrophage migration under inflammatory conditions (including Ccl5 and Lgals3) are significantly downregulated in Ltb4r2-/- macrophages polarized to an M1-like state .

  • In vitro migration: Transwell migration assays demonstrated that Ltb4r2-/- macrophages exhibit significantly reduced migration compared to wild-type cells .

  • Polarization-independent effects: While BLT2 significantly affects migration, it does not influence macrophage polarization into M1 (pro-inflammatory) or M2 (anti-inflammatory) states .

  • Confirmed with pharmacological inhibition: Treatment with the BLT2 antagonist LY255283 replicates the migration defects observed in Ltb4r2-/- macrophages, confirming that the phenotype results from loss of BLT2 function rather than secondary effects .

This evidence establishes BLT2 as a potential therapeutic target for inflammatory pathologies where excessive macrophage recruitment contributes to disease progression .

What are the validated methods for studying Ltb4r2 knockout effects in mice?

Several validated methodologies have been established for studying Ltb4r2 knockout effects:

  • Global knockout mouse models: Ltb4r2-/- mice have been characterized and validated to globally lack BLT2 expression without confounding reduction in the expression of the paralogue BLT1 .

  • Metabolic phenotyping: Body weight measurements combined with glucose and insulin tolerance tests can be used to assess whether BLT2 deficiency affects metabolism and development .

  • Macrophage polarization analysis: Flow cytometry using markers such as iNOS (for M1-like state) and CD206 (for M2-like state) can determine whether BLT2 influences macrophage polarization .

  • Transcriptomic profiling: Bulk RNA-sequencing of bone marrow-derived macrophages (BMDMs) from Ltb4r2-/- mice and wild-type littermates under different polarization conditions (M0, M1, M2) can identify BLT2-dependent gene expression changes .

  • Transwell migration assays: Placing isolated macrophages in the upper chamber of a chemotaxis system with FBS-RPMI media in the bottom chamber allows quantification of migration capacity over specific time periods (typically 4 hours) .

  • In vivo inflammation models: LPS-induced inflammation models can be used to assess macrophage infiltration in tissues and body cavities between Ltb4r2-/- mice and controls .

These methods collectively provide robust approaches to characterize the functional implications of BLT2 deficiency in macrophage biology and inflammatory responses.

How can zebrafish models be utilized to study Ltb4r2 function in inflammation?

Zebrafish represent a valuable model system for studying Ltb4r2 function in inflammation due to their genetic tractability and transparent larvae that facilitate real-time visualization:

  • Orthologue identification: Zebrafish have two genes encoding BLT2 (ltb4r2a and ltb4r2b), each with over 30% identity and 60% amino acid similarity to the human LTB4R2 sequence .

  • Developmental expression profiling: qRT-PCR from whole zebrafish embryos at different developmental stages (9 hpf and 1-5 dpf) can track the expression patterns of both ltb4r2a and ltb4r2b .

  • Transgenic reporter lines: The Tg(mpeg:eGFP) transgenic zebrafish line, where macrophages are labeled with GFP, enables visualization and quantification of macrophage dynamics .

  • Morpholino knockdown approach: Translation-blocking morpholino oligonucleotides (MO) against each ltb4r2 ortholog can be injected into zygotes to assess gene function .

  • Tailfin injury model: Mechanical tailfin injury in 3 dpf zebrafish larvae induces rapid macrophage migration to the injury site, which can be quantified 6 hours post-injury to assess inflammatory responses .

  • Validation of morpholino specificity:

    • Testing MO efficacy using modified GFP mRNA fused with the MO target sequence

    • Rescue experiments with synthetic ltb4r2a mRNA lacking the MO target sequence

    • Complementary pharmacological inhibition with BLT2 antagonists like LY255283

This zebrafish platform provides a powerful system to study BLT2 function during inflammation, particularly for investigating macrophage migration dynamics in real-time.

What are the current approaches for targeting Ltb4r2 in experimental therapeutics?

Current approaches for targeting Ltb4r2 in experimental therapeutics include:

  • Small molecule antagonists: BLT2 antagonists such as LY255283 have been validated in multiple model systems to inhibit BLT2 signaling and reduce macrophage migration during inflammation .

  • Genetic knockdown/knockout strategies:

    • Global knockout mouse models (Ltb4r2-/-) for systemic BLT2 deficiency

    • Tissue-specific conditional knockout models for targeted BLT2 deletion

    • Morpholino-based knockdown in zebrafish for developmental studies

  • Upstream enzyme inhibition: Targeting the enzymes responsible for producing BLT2 ligands, such as 5-LOX and 12-LOX inhibitors, has shown efficacy in reducing BLT2-mediated effects in KRAS-driven lung cancer models .

  • Combined targeting approaches: Simultaneous inhibition of BLT2 and related inflammatory pathways may provide synergistic effects, particularly in complex disease settings like cancer and chronic inflammation.

  • Antibody-based approaches: Development of neutralizing antibodies against BLT2 or its ligands represents another potential therapeutic strategy, particularly for tissue-specific targeting.

The choice of approach depends on the specific research question, disease model, and desired temporal control over BLT2 inhibition.

How do Ltb4r2 expression levels correlate with disease progression in cancer models?

Studies on the relationship between Ltb4r2 expression and cancer progression have revealed important insights:

  • KRAS-driven lung cancer: BLT2 expression levels are significantly elevated in the presence of mutant KRAS, suggesting a positive correlation with oncogenic transformation .

  • Clinical correlation: Analysis of tissue samples from patients with KrasG12D-expressing lung adenocarcinoma has demonstrated high BLT2 expression, supporting a relationship between BLT2 upregulation and human lung cancer development .

  • Mechanistic link via inflammatory mediators: BLT2-mediated production of IL-6 provides a mechanistic link between elevated BLT2 expression and tumor promotion, as IL-6 is a principal pro-inflammatory mediator of lung cancer development .

  • Functional validation: The significant reduction in tumor formation observed in Kras G12D/BLT2-KO double-mutant mice compared to Kras G12D single mutants confirms the functional importance of BLT2 expression in cancer progression .

These findings collectively suggest that BLT2 expression levels may serve as both a biomarker and a therapeutic target in certain cancer types, particularly those driven by KRAS mutations.

What controls should be included when studying Ltb4r2 function in knockout models?

When designing experiments to study Ltb4r2 function using knockout models, several critical controls should be included:

  • Wild-type littermate controls: Always compare Ltb4r2-/- mice with wild-type littermates to minimize genetic background variations .

  • Validation of knockout efficiency:

    • Confirm absence of BLT2 protein expression using Western blot (if antibodies are available)

    • Verify Ltb4r2 mRNA depletion using qRT-PCR

    • Check for compensatory upregulation of related receptors, particularly BLT1

  • Pharmacological validation: Complement genetic knockout with specific BLT2 antagonists (e.g., LY255283) to confirm that observed phenotypes are due to BLT2 deficiency rather than developmental adaptations .

  • Cell-type specific controls: For macrophage studies, include appropriate controls for cell density, viability, and differentiation status to ensure that observed phenotypes are not due to general defects .

  • Rescue experiments: Reintroduce wild-type Ltb4r2 expression in knockout cells/tissues to confirm phenotype reversal, which validates that observed effects are specifically due to Ltb4r2 deficiency .

  • Time-course analyses: Include multiple timepoints in inflammation and migration studies to distinguish between defects in initiation versus maintenance of responses.

  • Basal state assessments: Examine both unstimulated and stimulated conditions to determine whether Ltb4r2 deficiency affects basal functions or only responses to inflammatory triggers .

These controls collectively ensure robust and interpretable results when studying Ltb4r2 function in knockout models.

How should researchers optimize macrophage migration assays when studying Ltb4r2?

Optimizing macrophage migration assays for Ltb4r2 research requires attention to several methodological considerations:

  • Macrophage isolation and preparation:

    • Use standardized protocols for isolating peritoneal macrophages or differentiating bone marrow-derived macrophages (BMDMs)

    • Ensure consistent macrophage density and viability across experimental groups

    • Consider macrophage activation state (M0, M1, M2) based on experimental questions

  • Transwell chamber setup:

    • Optimize pore size (typically 5-8 μm) for macrophage migration

    • Standardize the number of cells loaded in the upper chamber

    • Determine optimal incubation time (typically 4 hours for initial assessment)

  • Chemoattractant selection:

    • Use 10% FBS-RPMI media as a general chemoattractant

    • Consider testing specific BLT2 ligands (LTB4, 12-HETE) at relevant concentrations

    • Include concentration gradients to assess dose-dependent effects

  • Controls and inhibitors:

    • Include positive controls (wild-type macrophages) and negative controls (no chemoattractant)

    • Test BLT2 antagonist (LY255283) at varying concentrations to establish dose-response relationships

    • Consider testing pathway inhibitors to identify downstream signaling mechanisms

  • Quantification methods:

    • Count cells that have migrated to the lower chamber using consistent methodology

    • Consider automated cell counting or flow cytometry for increased objectivity

    • Analyze data as both absolute cell numbers and percentage of input cells

  • Complementary approaches:

    • Live-cell imaging to assess migration dynamics in real-time

    • Wound healing assays for studying directional migration

    • In vivo migration models (such as zebrafish tailfin injury) to validate in vitro findings

Following these optimization strategies will enhance the reproducibility and interpretability of macrophage migration studies focused on Ltb4r2 function.

How can researchers address contradictory findings in Ltb4r2 functional studies?

When encountering contradictory findings in Ltb4r2 research, consider these systematic approaches:

  • Model system differences:

    • Assess whether contradictions arise from differences between in vitro and in vivo systems

    • Consider species-specific variations (e.g., mouse vs. zebrafish Ltb4r2 orthologs have different functions)

    • Evaluate cell line-specific effects versus primary cell responses

  • Genetic background effects:

    • Determine if knockout mice were generated on different genetic backgrounds

    • Consider using congenic strains to minimize background effects

    • Check for strain-specific compensatory mechanisms

  • Experimental condition variations:

    • Standardize concentration and source of inflammatory stimuli (LPS, cytokines)

    • Control timing of measurements relative to stimulus application

    • Consider microenvironmental differences that might influence Ltb4r2 function

  • Technical considerations:

    • Validate antibody specificity for Ltb4r2 detection

    • Verify knockout/knockdown efficiency across studies

    • Assess methodology differences in migration assays or inflammatory models

  • Receptor redundancy and compensation:

    • Investigate potential compensation by other leukotriene receptors (particularly BLT1)

    • Examine concurrent changes in related signaling pathways

    • Consider using double knockout approaches to address redundancy

  • Ligand specificity issues:

    • Determine which BLT2 ligands (LTB4, 12-HETE, other eicosanoids) were present in the experimental system

    • Assess the specificity of pharmacological inhibitors used across studies

    • Consider variations in endogenous ligand production across tissues

Systematically addressing these factors can help reconcile apparently contradictory findings and develop a more nuanced understanding of Ltb4r2 function in different biological contexts.

What are the common pitfalls in analyzing transcriptomic data from Ltb4r2-deficient macrophages?

When analyzing transcriptomic data from Ltb4r2-deficient macrophages, researchers should be aware of these common pitfalls:

  • Overlooking macrophage heterogeneity:

    • Macrophage populations may contain subsets with varying Ltb4r2 expression

    • Bulk RNA-seq might mask subset-specific effects

    • Consider single-cell RNA-seq approaches for heterogeneous populations

  • Insufficient polarization validation:

    • Verify M0, M1, and M2 polarization states with established markers

    • Consider that Ltb4r2 deficiency might alter response to polarizing stimuli

    • Include time-course analyses to capture dynamic transcriptional changes

  • Pathway analysis limitations:

    • Standard pathway databases may have incomplete annotation of Ltb4r2-related pathways

    • Gene Ontology terms might not capture specialized macrophage functions

    • Consider using macrophage-specific gene sets where available

  • Secondary effects misinterpretation:

    • Distinguish direct BLT2-dependent genes from secondary response genes

    • Consider that altered migration capacity might indirectly affect gene expression

    • Validate key findings with targeted approaches (qRT-PCR, protein expression)

  • Statistical threshold selection:

    • Overly stringent cutoffs might miss biologically relevant changes

    • The p < 0.05 cutoff used in some studies may include false positives

    • Consider fold-change thresholds alongside statistical significance

  • Context-dependent gene expression:

    • Ltb4r2-dependent gene expression may vary based on activation state

    • The largest differential gene expression was observed in the pro-inflammatory M1 state (153 genes) compared to M0 (100 genes) and M2 (68 genes)

    • Evaluate context-specific gene signatures rather than isolated gene changes

By addressing these pitfalls, researchers can improve the interpretation of transcriptomic data from Ltb4r2-deficient macrophages and develop more accurate models of BLT2 function in inflammation.

What are the promising therapeutic applications of Ltb4r2 modulation in inflammatory diseases?

Based on current research, several promising therapeutic applications for Ltb4r2 modulation exist:

  • KRAS-driven lung cancer:

    • BLT2 inhibition represents an attractive approach for treating KRAS-driven lung cancers, which have traditionally been difficult to target directly

    • Combining BLT2 antagonists with emerging KRAS inhibitors might provide synergistic benefits

  • Inflammatory bowel diseases:

    • Given BLT2's role in macrophage migration during inflammation, targeting this receptor might reduce inflammatory cell infiltration in IBD

    • Localized delivery of BLT2 antagonists to the intestinal mucosa could provide targeted anti-inflammatory effects

  • Chronic liver inflammation:

    • The high expression of Ltb4r2 in liver tissue suggests potential applications in non-alcoholic steatohepatitis (NASH) and other inflammatory liver conditions

    • Limiting macrophage recruitment via BLT2 inhibition might slow disease progression

  • Sepsis and acute inflammatory conditions:

    • BLT2 antagonism reduced macrophage infiltration in LPS-induced inflammation models, suggesting potential applications in sepsis

    • Rapid intervention with BLT2 antagonists during acute inflammatory events might limit tissue damage

  • Chronic inflammatory skin diseases:

    • Topical application of BLT2 modulators might provide localized control of inflammatory cell recruitment in conditions like psoriasis

  • Combination therapies:

    • Dual targeting of BLT1 and BLT2 might provide more comprehensive control of leukotriene signaling

    • Combining BLT2 antagonists with cytokine-targeted biologics could address multiple inflammatory pathways simultaneously

Future development of these therapeutic applications will require careful optimization of BLT2-targeting strategies and evaluation of potential side effects given BLT2's expression across multiple tissues.

What emerging technologies could advance our understanding of Ltb4r2 signaling mechanisms?

Several emerging technologies show promise for advancing our understanding of Ltb4r2 signaling:

  • CRISPR-based functional genomics:

    • Genome-wide CRISPR screens can identify novel components of BLT2 signaling pathways

    • CRISPR-mediated precise mutation of specific BLT2 domains can clarify structure-function relationships

    • Base editing approaches allow subtle modifications of BLT2 regulatory regions

  • Single-cell multi-omics:

    • Single-cell RNA-seq combined with proteomics can reveal cell-specific BLT2 signaling profiles

    • Spatial transcriptomics can map BLT2 expression patterns within tissues during inflammation

    • Trajectory analysis can track BLT2-dependent changes in macrophages during migration

  • Advanced imaging techniques:

    • Live-cell super-resolution microscopy can visualize BLT2 receptor dynamics

    • Intravital imaging in transgenic reporter mice can track BLT2-dependent macrophage behavior in vivo

    • Correlative light and electron microscopy can link BLT2 localization to subcellular structures

  • Computational modeling approaches:

    • Systems biology models of the BLT2 signaling network can predict responses to perturbations

    • Molecular dynamics simulations can reveal ligand-binding dynamics and receptor conformational changes

    • Machine learning algorithms can identify patterns in BLT2-dependent gene expression datasets

  • Tissue-specific inducible systems:

    • Conditional and inducible knockout models can disentangle developmental versus acute roles of BLT2

    • Tissue-specific BLT2 restoration in global knockout backgrounds can identify critical sites of action

    • Temporal control of BLT2 expression can reveal stage-specific functions in disease progression

  • Humanized mouse models:

    • Mice expressing human BLT2 can better model human disease and treatment responses

    • Patient-derived xenografts can assess BLT2 function in human cancer samples

    • Chimeric models can evaluate human macrophage BLT2 function in vivo

These technologies, especially when used in combination, hold significant potential for elucidating the complex biology of BLT2 signaling and advancing therapeutic applications.

What expression systems are optimal for producing functional recombinant mouse Ltb4r2?

Producing functional recombinant mouse Ltb4r2 requires careful consideration of expression systems:

  • Mammalian cell expression systems:

    • HEK293 cells: Provide proper post-translational modifications and folding for GPCRs

    • CHO cells: Offer stable expression and scalability for larger production

    • Mouse macrophage cell lines: Provide a native-like cellular environment for functional validation

  • Insect cell expression:

    • Baculovirus-infected Sf9 or High Five cells can produce higher yields of functional GPCRs

    • Suitable for structural studies requiring larger protein quantities

    • May have differences in glycosylation patterns compared to mammalian systems

  • Yeast expression systems:

    • Pichia pastoris can express functional GPCRs with proper folding

    • Cost-effective for larger scale production

    • May require optimization of membrane insertion and processing

  • Cell-free expression systems:

    • Allow rapid production for functional screening

    • Can incorporate non-natural amino acids for specialized studies

    • May have limitations in post-translational modifications

  • Optimization considerations:

    • Addition of signal sequences for proper membrane targeting

    • Codon optimization for the selected expression system

    • Fusion tags for detection and purification (with cleavage options)

    • Temperature and induction conditions to maximize functional expression

  • Validation approaches:

    • Ligand binding assays to confirm functionality

    • Downstream signaling assessments (calcium flux, cAMP production)

    • Proper membrane localization verification by microscopy or fractionation

The optimal expression system should be selected based on the specific research application, required protein yield, and functional validation requirements.

How can researchers validate the functional activity of recombinant Ltb4r2 preparations?

Comprehensive validation of recombinant Ltb4r2 functionality requires multiple complementary approaches:

  • Expression and solubility verification:

    • Western blotting with BLT2-specific antibodies

    • Fluorescence-based detection of tagged receptors

    • Membrane fraction analysis to confirm proper localization

  • Ligand binding assays:

    • Competitive binding assays with radiolabeled or fluorescent LTB4

    • Saturation binding to determine Kd values for multiple ligands (LTB4, 12-HETE)

    • Association/dissociation kinetics to characterize binding dynamics

  • Functional signaling assays:

    • G-protein coupling assessment (typically Gαi for BLT2)

    • Calcium mobilization assays following ligand stimulation

    • ERK phosphorylation or other downstream signaling events

    • cAMP or inositol phosphate production measurements

  • Receptor internalization studies:

    • Fluorescence microscopy to track receptor trafficking

    • Flow cytometry to quantify surface receptor levels pre/post-stimulation

    • BRET/FRET approaches to monitor protein-protein interactions

  • Cell-based functional assays:

    • Chemotaxis assays using cells expressing recombinant BLT2

    • Comparison with native BLT2 responses in macrophages

    • Inhibition studies with validated BLT2 antagonists (LY255283)

  • Biophysical characterization:

    • Circular dichroism to assess secondary structure

    • Thermal stability assays to evaluate protein quality

    • Size exclusion chromatography to confirm homogeneity

  • Comparative analysis:

    • Side-by-side comparison with native BLT2 from mouse macrophages

    • Evaluation against known BLT2 mutants with altered function

    • Cross-species comparison with human BLT2 to assess conservation of function

These validation approaches collectively ensure that recombinant Ltb4r2 preparations retain the structural and functional properties necessary for meaningful research applications.

What are the key unresolved questions in Ltb4r2 research?

Despite significant advances, several key questions remain unresolved in Ltb4r2 research:

  • Signaling specificity:

    • How does BLT2 distinguish between multiple ligands (LTB4, 12-HETE, etc.)?

    • What determines the specificity of downstream signaling pathways?

    • How is BLT2 signaling integrated with other inflammatory receptors?

  • Tissue-specific functions:

    • Why is BLT2 highly expressed in liver and spleen, and what functions does it serve there?

    • What explains the differential roles of zebrafish BLT2 orthologs (ltb4r2a vs. ltb4r2b)?

    • How do tissue-specific BLT2 functions contribute to systemic inflammatory responses?

  • Regulation mechanisms:

    • How is BLT2 expression regulated during inflammation and cancer?

    • What factors control BLT2 desensitization and internalization?

    • Are there endogenous negative regulators of BLT2 signaling?

  • Cancer biology:

    • Beyond KRAS-driven lung cancer, what roles does BLT2 play in other cancer types?

    • How does BLT2 contribute to tumor microenvironment modulation?

    • Can BLT2 expression serve as a prognostic biomarker?

  • Therapeutic targeting:

    • What are the long-term consequences of systemic BLT2 inhibition?

    • How can BLT2 antagonists be delivered to specific tissues?

    • Are there therapeutic windows where BLT2 modulation is most effective?

  • Evolutionary considerations:

    • Why have two BLT2 orthologs with potentially distinct functions been maintained in zebrafish?

    • How have BLT2 functions diverged across species?

    • What selective pressures have shaped BLT2 ligand specificity?

Addressing these questions will require integrative approaches combining molecular, cellular, and in vivo studies across multiple model systems.

How might single-cell approaches advance our understanding of Ltb4r2 in heterogeneous immune populations?

Single-cell technologies offer transformative potential for understanding Ltb4r2 biology in complex immune environments:

  • Cell type-specific expression patterns:

    • Single-cell RNA-seq can precisely map BLT2 expression across immune cell subpopulations

    • Identification of previously unrecognized BLT2-expressing cell types

    • Correlation of BLT2 expression with other inflammatory mediators at single-cell resolution

  • Functional heterogeneity:

    • Single-cell proteomics can link BLT2 protein levels to activation states

    • Phospho-proteomic analysis can track BLT2 signaling in individual cells

    • Mass cytometry can simultaneously assess multiple BLT2-associated pathways

  • Temporal dynamics:

    • Single-cell trajectory analysis can track how BLT2 expression changes during macrophage differentiation and activation

    • RNA velocity approaches can predict future states of BLT2-expressing cells

    • Cellular indexing of transcriptomes and epitopes (CITE-seq) can link BLT2 expression to surface marker dynamics

  • Spatial context:

    • Spatial transcriptomics can map BLT2 expression patterns within inflammatory microenvironments

    • Multiplexed ion beam imaging can correlate BLT2 with dozens of other proteins in tissue sections

    • Neighborhood analysis can identify cellular interactions involving BLT2-expressing cells

  • Response heterogeneity:

    • Single-cell perturbation screens can identify cell-specific responses to BLT2 modulation

    • Drug response profiling at single-cell resolution can reveal subpopulation-specific effects of BLT2 antagonists

    • Genetic variation analysis can link individual cellular responses to genomic features

  • Computational integration:

    • Multi-modal data integration can create comprehensive models of BLT2 function

    • Machine learning approaches can identify patterns in BLT2-associated single-cell data

    • Network analysis can position BLT2 within cell type-specific signaling networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.