Recombinant Mouse Lipase maturation factor 1 (Lmf1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipase Maturation

Lmf1 is an ER-resident transmembrane protein essential for the post-translational maturation of dimeric lipases, including:

  • Lipoprotein lipase (LPL)

  • Hepatic lipase (HL)

  • Endothelial lipase (EL)

Key Mechanisms

  1. Dimer Assembly: Lmf1 stabilizes head-to-tail homodimers of lipases by resolving misfolded intermediates and preventing premature degradation .

  2. Redox Regulation: It assists in reducing inappropriate intermolecular disulfide bonds in LPL and other client proteins (e.g., fibronectin, LDL receptor) .

  3. Quality Control: Acts as a chaperone to ensure proper glycosylation and folding of nascent lipase polypeptides in the ER .

Critical Dependency: Pancreatic lipase (PL), which functions as a monomer, does not require Lmf1, underscoring its specificity for dimeric lipases .

Production and Quality Control

The recombinant Mouse Lmf1 protein is synthesized via bacterial expression (e.g., E. coli) and purified using nickel affinity chromatography.

Transgenic and Genetic Studies

Study TypeKey FindingsSource
Mouse OverexpressionElevated Lmf1 levels increase LPL activity in adipose, heart, and muscle tissues
Human Genetic AssociationsLMF1 SNPs (e.g., rs3751666) correlate with post-heparin LPL activity in dyslipidemic cohorts

Mechanistic Insight: Lmf1 acts as a rate-limiting factor in lipase maturation, influencing both specific activity (enzymatic efficiency) and protein mass (tissue-dependent effects) .

Disease Implications

  • Hypertriglyceridemia: Loss-of-function mutations in LMF1 cause combined lipase deficiency, leading to severe hypertriglyceridemia and early mortality in mice .

  • Therapeutic Potential: Modulating Lmf1 expression could target lipid disorders, though challenges remain in translating findings to human therapies .

Beyond Lipases

Lmf1 assists in folding non-lipase proteins, such as fibronectin and LDL receptor, highlighting its broader role in ER protein quality control .

Experimental and Clinical Relevance

Recombinant Mouse Lmf1 serves as a versatile tool for:

  1. Structural Studies: Elucidating dimerization mechanisms of lipases.

  2. Disease Modeling: Reconstituting Lmf1-deficient systems to study hypertriglyceridemia.

  3. Diagnostic Development: Identifying biomarkers for lipid metabolism disorders.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Lmf1; Tmem112; Lipase maturation factor 1; Transmembrane protein 112
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-574
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lmf1
Target Protein Sequence
MRPDSLVMAAPEGSLRKRKVGGAEHSPASQPSLARDPADSPARLHTGTFWLTRIVLLRAL AFIYFVAFLVAFNQNKALIGDRGLLPCKLYLKNVQEYFQGSTGWAAWTYAPTIMWLLDWS DMNFNLDLIALLGLGISSFVLVTGCANMILMTALWALYMSLVNVGQIWYSFGWESQLLET GFLGIFLSPLWTLSRLPKNTPTSQIVLWGFRWLIFRIMLGAGLIKVRGDKCWLDLTCMDF HYETQPVPNPIAYYLHRSPWWFHRFETLSNHFVELLVPFFLFLGRRMRILHGVLQILFQV ILIISGNLSFLNWLTIVPSLACFDDAALGFLFPSGPQGLKKQVLEIQREDTQRVQPKPRD RGCLVRQVVNISLGILVAWLSVPVVINLLSSRQIMNTSFNPLRIVNTYGAFGSVTKERTE VILQGTVSPNASAPDAVWEDYEFKCKPGDPWRQPCLISPYHYRLDWLMWFAAFQTYEQNE WILHLAGKLLAGDSEALALLAVNPFEGRTPPRWIRGEHYRYKFSLPGGQHATQGKWWIRK RIGPYFPPLRLEDLKEYFKTREWPLPEPPSRHTR
Uniprot No.

Target Background

Function
Lipase maturation factor 1 (LMF1) is involved in the maturation of specific proteins within the endoplasmic reticulum. It plays a crucial role in the maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway. Each LMF1 molecule chaperones 50 or more LPL molecules.
Gene References Into Functions
  1. A study identified the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in primary cultured cells. PMID: 25035425
  2. Variations in Lmf1 expression are a posttranslational determinant of LPL activity. PMID: 22345169
  3. LMF1 is essential for endothelial lipase activity. Mutations in Lmf1 lead to severe hypertriglyceridemia in mice and human subjects. PMID: 21447484
  4. Research shows that cotransfection of LPL with wild-type Lmf1 restores its ability to support normal lipase maturation. PMID: 19471043
  5. Data reveals the arrangement of an evolutionarily conserved domain within LMF1 (DUF1222) that is essential for lipase maturation. PMID: 19783858
  6. A study identified the gene containing the cld mutation as Tmem112 and renamed it Lmf1 (Lipase maturation factor 1); Lmf1 encodes a transmembrane protein with an evolutionarily conserved domain of unknown function that localizes to the ER. PMID: 17994020

Show More

Hide All

Database Links
Involvement In Disease
Defects in Lmf1 are the cause of combined lipase deficiency (cld). Cld is characterized by severe hypertriglyceridemia with accumulation of chylomicrons that gradually pack the lumina of capillaries and sinusoids. Severe hypertriglyceridemia causes an increase in blood viscosity, ischemia, and cyanosis, and the inability of tissues to access circulating triglycerides results in starvation, poor thermoregulation, and death 2 to 3 days after birth. The disorder is caused by a decrease in the activity of lipoprotein lipase (Lpl) and the related hepatic lipase (Lipc), caused by impaired maturation of nascent Lpl and hepatic lipase polypeptides in the endoplasmic reticulum.
Protein Families
Lipase maturation factor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues synthesizing lipoprotein lipase (Lpl) and hepatic lipase (Lipc), including adipose tissue, skeletal muscle, heart, and liver. Expressed at higher levels in tissues that express little or no lipase activity such as testis and pancr

Q&A

What is Lipase Maturation Factor 1 (Lmf1) and what is its primary function?

Lmf1 is an endoplasmic reticulum (ER) membrane protein that functions as a critical chaperone in the post-translational maturation of select lipases. It is essential for the proper folding and assembly of lipoprotein lipase (LPL), hepatic lipase (HL), and endothelial lipase (EL) into active enzymes. Without functional Lmf1, these lipases fail to attain enzymatic activity despite normal transcription and translation . The protein plays a crucial role in facilitating the transition from inactive lipase polypeptides to functional dimeric enzymes within the ER, making it an essential component of lipid metabolism pathways.

What is the molecular structure and cellular localization of Lmf1?

Lmf1 is a polytopic membrane protein localized to the endoplasmic reticulum. Experimental evidence supports a five-transmembrane model that divides Lmf1 into six distinct domains. Three domains (the amino-terminal domain and loops B and D) face the cytoplasm, while the other three domains (loops A and C and the carboxyl-terminal domain) are oriented toward the ER lumen . The protein contains an evolutionarily conserved domain known as DUF1222, which comprises four of the six domains and is essential for lipase maturation. The two largest domains of DUF1222 face the ER lumen, which is consistent with its role in interacting with nascent lipase proteins in this compartment.

How do mutations in Lmf1 affect lipase activity?

Loss-of-function mutations in Lmf1 result in a condition known as "combined lipase deficiency," characterized by diminished LPL, HL, and EL activities. These enzymatic deficiencies lead to severe hypertriglyceridemia in both mice and humans . Importantly, the lipase protein levels are often unaffected, but the proteins are misfolded, causing aggregation and retention of inactive lipase in the ER. Studies have identified specific human mutations (including Y439X and W464X) that result in truncated LMF1 proteins lacking the ability to properly mature lipases, leading to metabolic disorders characterized by severe hypertriglyceridemia .

What are the optimal conditions for expressing recombinant mouse Lmf1 in vitro?

For recombinant expression of mouse Lmf1, prokaryotic expression systems using E. coli have been successfully employed, though mammalian expression systems are preferred when studying functional interactions with lipases. When using E. coli, fusion tags (such as N-terminal His tags) can facilitate purification . For functional studies, it's essential to use expression vectors that preserve the transmembrane topology of Lmf1, as its membrane orientation is critical for interaction with target lipases.

The protein should be reconstituted in appropriate buffers (e.g., 20mM Tris, 150mM NaCl, pH 8.0) at concentrations of 0.1-1.0 mg/mL . Due to its multiple transmembrane domains, detergents may be necessary for solubilization when extracting from membranes. When expressing in mammalian cells, vectors containing ER-targeting sequences should be used to ensure proper localization, and expression can be verified using techniques such as immunofluorescence microscopy targeting the ER.

How can I assess the functional activity of recombinant Lmf1 in experimental systems?

The functional activity of recombinant Lmf1 is best assessed by measuring its ability to restore lipase activity in Lmf1-deficient systems. The most common approach involves complementation assays using cells harboring the combined lipase deficiency (cld) mutation. These cells are transfected with recombinant Lmf1 along with a lipase (LPL, HL, or EL), and subsequently assessed for lipase activity using enzymatic assays .

For lipoprotein lipase activity, the release of free fatty acids from triglyceride substrates can be measured. Post-heparin plasma can be collected from experimental animals to assess circulating lipase activity. In human studies, post-heparin LPL activity has been measured in μmol FA/h/ml, with typical values for wild-type LMF1 around 225 ± 1.07 μmol FA/h/ml . Co-immunoprecipitation experiments can also demonstrate physical interaction between Lmf1 and its target lipases, confirming proper chaperone function. When designing these experiments, it's important to include appropriate controls, such as inactive Lmf1 mutants (e.g., those modeling Y439X or W464X human mutations).

What are the recommended methods for purifying recombinant mouse Lmf1?

Purification of recombinant mouse Lmf1 presents challenges due to its multiple transmembrane domains. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resins under native or denaturing conditions can be employed. When expressed in E. coli, inclusion bodies often form, necessitating solubilization with chaotropic agents followed by refolding protocols.

For functional studies requiring properly folded protein, mammalian expression systems are preferred, followed by detergent-based extraction (using mild detergents like digitonin or DDM) and affinity purification. Size exclusion chromatography can be used as a final purification step to obtain homogeneous protein preparations. It's important to note that due to post-translational modifications, the apparent molecular weight on SDS-PAGE (approximately 21kDa for certain constructs) may differ from the predicted molecular weight (27.1kDa) . Multiple quality control steps, including Western blotting and activity assays, should be performed to confirm the identity and functionality of the purified protein.

How can transgenic Lmf1 expression be used to study lipase regulation in vivo?

Transgenic overexpression of Lmf1 in specific tissues has proven valuable for investigating its role in lipase regulation. Studies have successfully used tissue-specific promoters (such as aP2 for adipose tissue and Mck for cardiac and skeletal muscle) to drive Lmf1 expression in target tissues . These models allow researchers to examine whether Lmf1 is a rate-limiting factor in lipase maturation in physiological contexts.

Research has demonstrated that transgenic overexpression of Lmf1 results in increased LPL activity in adipose, heart, and muscle tissues. Interestingly, the mechanism appears to differ between tissues: in some adipose depots (omental and subcutaneous), Lmf1 overexpression increases LPL specific activity without affecting LPL mass, while in heart and gonadal adipose tissue, it increases LPL mass without changing specific activity . When designing transgenic studies, researchers should consider appropriate controls, physiologically relevant Lmf1 expression levels, and comprehensive phenotypic analysis including lipid profiles, tissue-specific lipase activities, and metabolic parameters.

What is the relationship between Lmf1 genetic variants and lipase activities in human populations?

Human genetic studies have revealed significant associations between LMF1 gene variants and post-heparin LPL activity. Tag-SNP approaches have identified polymorphisms that correlate with variable lipase activities in human cohorts. For example, the rs3751666 G/G genotype has been associated with lower LPL activity (210 ± 1.1 μmol FA/h/ml) compared to the A/A genotype (225 ± 1.07 μmol FA/h/ml) . These findings suggest that natural variation in LMF1 expression or function can modulate lipase activities and potentially influence lipid metabolism in human populations.

When designing association studies, researchers should carefully select SNPs that capture the genetic diversity of the LMF1 locus, adjust for relevant covariates (age, sex, medications, etc.), and consider population stratification. Functional follow-up studies are essential to determine the molecular mechanisms by which identified variants affect LMF1 expression or function. Additionally, examining the interaction between LMF1 variants and environmental factors (such as diet and physical activity) may provide insights into the complex regulation of lipid metabolism.

What techniques can be used to study the Lmf1-lipase interaction domain in detail?

The interaction between Lmf1 and its target lipases occurs primarily through loop C within the DUF1222 domain, which faces the ER lumen . Several techniques can be employed to study this interaction in detail:

  • Site-directed mutagenesis: Systematic mutation of conserved residues within loop C can identify specific amino acids critical for lipase binding and maturation.

  • Truncation studies: Creating truncated versions of Lmf1 that preserve or disrupt the lipase interaction domain can validate the functional importance of specific regions.

  • Cross-linking coupled with mass spectrometry: This approach can identify specific residues at the Lmf1-lipase interface by chemically linking interacting proteins followed by proteolytic digestion and mass spectrometric analysis.

  • FRET/BRET analysis: These techniques can monitor protein-protein interactions in living cells by tagging Lmf1 and lipases with appropriate fluorescent or bioluminescent proteins.

  • Hydrogen-deuterium exchange mass spectrometry: This method can map conformational changes and interaction surfaces by measuring the rate of hydrogen-deuterium exchange in different protein regions.

When designing these experiments, researchers should consider controls that distinguish specific from non-specific interactions, and validate findings using multiple complementary approaches.

What are the key differences between mouse and human Lmf1 that may affect experimental design?

How can CRISPR-Cas9 genome editing be optimized for studying Lmf1 function?

CRISPR-Cas9 genome editing offers powerful approaches for studying Lmf1 function through knockout, knockin, or precise mutation of the endogenous gene. When designing CRISPR-Cas9 strategies for Lmf1 research, several considerations are important:

  • Guide RNA design: Multiple guide RNAs targeting different exons should be tested, preferably those encoding the DUF1222 domain or transmembrane regions essential for function.

  • Off-target analysis: Comprehensive bioinformatic screening should be performed to minimize off-target effects, and multiple independent cell lines or animal models should be characterized.

  • Functional readouts: Clear phenotypic assays must be established, including measurement of lipase activities, lipid profiles, and cellular localization of affected lipases.

  • Rescue experiments: Complementation with wild-type or mutant Lmf1 constructs can confirm the specificity of observed phenotypes and characterize structure-function relationships.

  • Temporal control: Inducible CRISPR systems can help distinguish developmental from acute effects of Lmf1 deficiency.

These approaches can be particularly valuable for creating cellular or animal models that recapitulate human LMF1 mutations or for introducing tagged versions of Lmf1 for tracking endogenous protein dynamics.

What are the challenges in interpreting discrepancies between in vitro and in vivo Lmf1 studies?

Several factors may contribute to these discrepancies:

  • Cellular environment: The ER environment in different tissues may vary in terms of calcium concentration, redox state, and presence of additional chaperones, affecting Lmf1 function.

  • Compensatory mechanisms: In vivo, partial redundancy or compensation by other ER factors may mask some effects of altered Lmf1 expression.

  • Lipase-specific dependencies: Different lipases show varying degrees of dependence on Lmf1, with LPL being more affected than HL by Lmf1 deficiency .

  • Tissue-specific factors: Lmf1 overexpression increases LPL specific activity in some adipose depots but increases LPL mass without changing specific activity in heart tissue .

When designing and interpreting experiments, researchers should account for these complexity factors, ideally combining in vitro mechanistic studies with in vivo validation across multiple tissues and physiological conditions.

How might novel small molecule modulators of Lmf1 be discovered and developed for research applications?

The discovery of small molecule modulators of Lmf1 function could provide valuable research tools and potential therapeutic leads. Several strategies could be employed for this purpose:

  • High-throughput screening: Cell-based assays measuring lipase activity in Lmf1-expressing versus control cells could identify compounds that enhance or inhibit Lmf1-mediated lipase maturation.

  • Structure-based design: As structural information about Lmf1 and its interaction with lipases becomes available, rational design approaches could target specific binding interfaces.

  • Fragment-based screening: This approach could identify initial chemical matter that interacts with key Lmf1 domains, which could then be optimized for potency and selectivity.

  • Phenotypic screening: Compounds could be screened for their ability to rescue lipase activity in cells harboring Lmf1 mutations, potentially identifying molecules that stabilize mutant Lmf1 or provide alternative maturation pathways.

For validation, researchers should employ orthogonal assays that confirm target engagement (e.g., thermal shift assays, cellular thermal shift assays) and rule out non-specific effects. Promising compounds should be characterized for their mechanism of action, specificity across different lipases, and activity in relevant disease models such as hypertriglyceridemia.

What are the emerging techniques for studying Lmf1 interactions with the ER quality control machinery?

Emerging techniques are expanding our ability to study how Lmf1 interfaces with the broader ER quality control machinery. These approaches include:

  • Proximity labeling: BioID or APEX2 fusions to Lmf1 can identify proteins in close proximity within the ER, potentially revealing novel interaction partners in the quality control machinery.

  • Live-cell imaging: Advanced microscopy techniques such as lattice light-sheet microscopy combined with specific labeling strategies can visualize Lmf1-lipase interactions and their trafficking within the ER in real time.

  • Single-cell analysis: Single-cell transcriptomics and proteomics can reveal how Lmf1 and the ER quality control system respond to various stressors or lipid challenges at the individual cell level.

  • Cryo-electron tomography: This technique can visualize the native arrangement of Lmf1 within the ER membrane and its association with lipases and other components of the quality control machinery.

  • Integrative structural biology: Combining multiple structural approaches (X-ray crystallography, cryo-EM, NMR, cross-linking MS) can provide comprehensive models of Lmf1 in complex with lipases and other ER factors.

These techniques promise to reveal how Lmf1 functions within the broader context of ER protein quality control, potentially identifying new therapeutic targets for disorders of lipid metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.