Recombinant Mouse Lipid phosphate phosphatase-related protein type 5 (Lppr5)

Shipped with Ice Packs
In Stock

Description

Gene Names and Alternative Designations

Mouse Lipid phosphate phosphatase-related protein type 5 is encoded by a gene with multiple designations in scientific literature. The primary gene name is Lppr5, though it is frequently referred to by several alternative names including Plppr5 (phospholipid phosphatase related 5), PRG-5 (plasticity-related gene 5), Pap2d (phosphatidic acid phosphatase 2d), and 4833424O15Rik . This diversity in nomenclature reflects the protein's discovery through different research approaches and its classification within multiple protein families based on structure and function.

Protein Structure and Classification

Lppr5 belongs to the lipid phosphate phosphatase family, a group of membrane-associated enzymes involved in phospholipid metabolism and signaling. While the specific structural details of mouse Lppr5 are not extensively documented in the provided search results, it shares functional domains with other members of this family. The recombinant form of mouse Lppr5 is produced with at least 85% purity as determined by SDS-PAGE, making it suitable for various research applications .

Production Systems for Recombinant Protein

Recombinant Mouse Lppr5 can be expressed in multiple production systems, allowing researchers flexibility in selecting the appropriate expression platform based on their specific requirements. These systems include bacterial expression (E. coli), yeast-based expression, baculovirus-infected insect cells, and mammalian cell expression systems . Each system offers distinct advantages regarding protein folding, post-translational modifications, and yield, which can significantly impact the protein's functionality in experimental settings.

Modulation of Rho-GTPase Pathway

One of the most significant aspects of Lppr5 biology is its role as a modulator of the canonically oncogenic Rho-GTPase pathway . This pathway regulates numerous cellular processes including cytoskeletal dynamics, cell migration, and proliferation. Lppr5's interaction with this pathway positions it as a pivotal molecule influencing fundamental cellular behaviors, particularly in the context of neural development and neoplastic transformation.

Role in Normal Physiology

While the specific physiological functions of Lppr5 in normal tissues are not extensively detailed in the available search results, its expression patterns and the consequences of its dysregulation suggest important roles in maintaining cellular homeostasis. By modulating key signaling pathways, Lppr5 likely contributes to processes such as cell division, migration, and differentiation in various tissues, particularly within the nervous system.

Expression Patterns in Glioma

Research has revealed significant alterations in LPPR5 expression across different neoplastic conditions, particularly in gliomas. Notably, LPPR5 expression appears to be reduced in neoplasia with higher WHO classifications, indicating a potential correlation between LPPR5 downregulation and tumor aggressiveness . This pattern is particularly pronounced in glioblastoma tumors, which frequently exhibit downregulated LPPR5 expression compared to other neoplastic entities .

Genetic Alterations in Tumors

The genetic basis for altered LPPR5 expression in tumors has been investigated, with findings indicating that deletion of LPPR5 is common in oligodendrogliomas, although not exclusive to this tumor type . Interestingly, in oligodendrogliomas with haploid loss of LPPR5, the reduced expression from the deleted allele appears to be compensated by the remaining functional allele . This observation suggests complex regulatory mechanisms governing LPPR5 expression in different tumor contexts.

Functional Impact on Tumor Biology

Studies utilizing GL261 murine orthotopic allograft glioma models have provided compelling evidence for LPPR5's functional significance in tumor progression. Notably, LPPR5 overexpression (LPPR5 OE) results in delayed and decelerated glioma growth . This growth inhibition is associated with increased tumor cell apoptosis and decreased expression and secretion of vascular endothelial growth factor A (VEGF-A) . These findings position LPPR5 as a potential tumor suppressor in glioma, with its downregulation potentially contributing to more aggressive disease phenotypes.

Effects on Tumor Vasculature

A particularly intriguing aspect of LPPR5 biology in tumors relates to its impact on the tumor microvasculature. LPPR5 overexpression leads to an altered micro-angioarchitecture characterized by dysfunctional small blood vessels . This vascular phenotype has implications for tumor perfusion and potentially for the delivery of therapeutic agents. Interestingly, while treatment with the anti-angiogenic agent sunitinib eliminates these dysfunctional vessels, it does not affect tumor growth or apoptosis in LPPR5-overexpressing gliomas . This observation suggests complex interactions between LPPR5, tumor vasculature, and response to anti-angiogenic therapies.

LPPR5 as a Prognostic Biomarker

The observed correlations between LPPR5 expression levels and tumor aggressiveness suggest potential applications for LPPR5 as a prognostic biomarker in gliomas. Reduced LPPR5 expression may indicate more aggressive disease and potentially inform treatment decisions . Further validation studies in large patient cohorts would be necessary to establish the clinical utility of LPPR5 as a biomarker.

Therapeutic Targeting of LPPR5 Pathways

The pro-apoptotic, slowly proliferating phenotype associated with LPPR5 expression in glioma models suggests potential therapeutic strategies centered on restoring or enhancing LPPR5 activity in tumors . Additionally, the interaction between LPPR5 and response to anti-angiogenic therapy highlights potential applications in combination treatment approaches. Understanding how LPPR5 modulates the Rho-GTPase pathway may reveal additional therapeutic targets within this signaling network.

Experimental Models and Tools

Recombinant Mouse Lppr5 serves as a valuable research tool for investigating the protein's functions in various experimental systems. With high purity (≥85% as determined by SDS-PAGE), recombinant preparations enable precise studies of Lppr5's biochemical properties and interactions with other molecules . The availability of recombinant protein from multiple expression systems (bacterial, yeast, baculovirus, and mammalian) facilitates diverse experimental approaches, from structural studies to functional assays in cellular systems.

Comparative Studies with Human LPPR5

While this review focuses specifically on Mouse Lppr5, it is worth noting that human LPPR5 (also known as PLPPR5, PAP2, PRG5, or PAP2D) is also available as a recombinant protein . Comparative studies between mouse and human LPPR5 can provide valuable insights into the conservation of function across species and potentially inform the translational relevance of findings from mouse models to human disease contexts.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format during order placement, and we will accommodate your request whenever possible.
Lead Time
Delivery timelines may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: Our default shipping method includes standard blue ice packs. If you require dry ice packaging, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. For reconstitution, please use deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
If you have a preference for a particular tag type, please inform us, and we will prioritize its inclusion during production whenever feasible.
Synonyms
Plppr5; Lppr5; Phospholipid phosphatase-related protein type 5; Lipid phosphate phosphatase-related protein type 5; Plasticity-related gene 5 protein; PRG-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plppr5
Target Protein Sequence
MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQPENGHIHRDNVARMPMTNIPRV ESPLEKVTSLQNHVTAFAEVT
Uniprot No.

Target Background

Function
This protein induces filopodia formation and promotes neurite growth in a CDC42-independent manner. It also impedes neurite growth inhibitory-mediated axonal retraction.
Gene References Into Functions
  1. Research indicates that plasticity-related genes 5 (PRG5) expression plays a crucial role in proper spine formation. PMID: 25074937
  2. Data show that PRG5 induces filopodia growth independently of Cdc42. Furthermore, axon collapse and RhoA activation induced by LPA and myelin-associated neurite inhibitor Nogo-A are attenuated in the presence of PRG5. PMID: 20032306
Database Links

KEGG: mmu:75769

UniGene: Mm.72187

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Lppr5 in cellular lipid metabolism?

Lppr5 belongs to the family of lipid phosphate phosphatases that play critical roles in cellular signaling pathways. As a membrane-associated enzyme, Lppr5 catalyzes the dephosphorylation of phospholipid substrates, thereby regulating lipid-mediated signaling cascades. Similar to other phosphatidylinositol-metabolizing enzymes, Lppr5 likely influences membrane dynamics and composition, potentially affecting downstream cellular processes through modulation of phospholipid metabolism . The protein contains characteristic transmembrane domains and catalytic motifs essential for its enzymatic activity on the membrane surface, which parallels mechanisms seen in other lipid-modifying enzymes such as PIP5K that generate PI(4,5)P2 lipids at the plasma membrane.

What tissue distribution patterns and expression levels are typical for mouse Lppr5?

Mouse Lppr5 demonstrates tissue-specific expression patterns with predominant expression in neural tissues, particularly during developmental stages. Expression levels vary significantly across different brain regions and developmental timepoints, suggesting temporally regulated functions. Quantitative analyses have revealed notable expression in the cerebellum, hippocampus, and certain cortical regions. This distribution pattern indicates potential specialized roles in neural development and function, possibly in myelination processes or neuronal signaling, similar to other lipid-modifying enzymes that have been implicated in membrane organization in specialized cellular contexts . Regional and temporal expression patterns can be assessed using RT-PCR and immunohistochemical approaches similar to those described for other recombinant mouse proteins .

What expression systems are most effective for producing functional recombinant mouse Lppr5?

For mammalian membrane proteins like Lppr5, mammalian expression systems typically yield the most functionally relevant recombinant protein. The optimal approach involves cloning the Lppr5 coding sequence into a mammalian expression vector containing a strong promoter such as CMV, similar to the procedure described for other recombinant mouse proteins . HEK293 or CHO cells are preferred host systems due to their capacity to perform appropriate post-translational modifications and proper membrane protein folding. The expression construct should incorporate an affinity tag (His6 or FLAG) at either the N- or C-terminus to facilitate purification while ensuring minimal interference with protein function.

The expression protocol should include:

  • Transfection of expression plasmid into host cells using lipid-based transfection reagents

  • Culture of transfected cells for 48-72 hours in advanced DMEM/F12 medium supplemented with fetal bovine serum

  • Verification of expression by Western blotting using tag-specific antibodies

  • Optimization of expression conditions including temperature reduction to 32°C during expression phase to enhance proper folding

For stable expression, selection with appropriate antibiotics followed by clonal selection yields consistent long-term production of the recombinant protein .

What purification strategies overcome the challenges associated with membrane-bound Lppr5?

Purifying membrane-bound Lppr5 requires specialized approaches to maintain protein stability and activity. A multi-step purification strategy is recommended:

  • Membrane fraction isolation:

    • Harvest cells and resuspend in lysis buffer containing protease inhibitors

    • Disrupt cells using sonication or nitrogen cavitation

    • Separate membrane fraction through differential centrifugation (100,000×g for 1 hour)

  • Solubilization:

    • Solubilize membrane fraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin (0.5-1%)

    • Incubate with gentle rotation at 4°C for 1-2 hours

    • Remove insoluble material by centrifugation (100,000×g for 30 minutes)

  • Affinity chromatography:

    • Apply solubilized fraction to appropriate affinity resin (Ni-NTA for His-tagged proteins)

    • Wash extensively with buffer containing reduced detergent concentration

    • Elute with imidazole gradient or specific peptide for FLAG-tagged proteins

  • Size exclusion chromatography:

    • Apply eluted protein to size exclusion column equilibrated with buffer containing 0.05% detergent

    • Collect fractions and analyze by SDS-PAGE and Western blotting

This approach addresses the challenges of maintaining membrane protein integrity while achieving sufficient purity for downstream applications.

How can enzymatic activity of purified recombinant Lppr5 be verified and quantified?

Verification of Lppr5 enzymatic activity requires specialized phosphatase assays that account for its membrane association and lipid substrate specificity:

  • Phosphate release assay:

    • Incubate purified Lppr5 with appropriate phospholipid substrates in micelles or liposomes

    • Measure released inorganic phosphate using malachite green or similar colorimetric methods

    • Calculate specific activity (μmol phosphate released/min/mg protein)

  • Fluorescent substrate assay:

    • Utilize fluorescently labeled phospholipid substrates

    • Monitor dephosphorylation through changes in fluorescence intensity

    • Determine enzyme kinetics (Km, Vmax) under various conditions

  • Membrane-based activity assays:

    • Reconstitute Lppr5 into liposomes of defined composition

    • Measure activity in this near-native membrane environment

    • Assess the influence of membrane composition on catalytic efficiency, similar to approaches used for PIP5K

Quantification should include:

  • Determination of specific activity under standardized conditions

  • Establishment of substrate preference profile

  • Assessment of pH and cation dependency

  • Evaluation of potential inhibitors or activators

These methods provide comprehensive characterization of Lppr5 enzymatic properties while accounting for its membrane-associated nature.

What approaches are most effective for analyzing potential dimerization or oligomerization of Lppr5?

Analysis of Lppr5 oligomerization state requires multiple complementary approaches:

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

    • Analyze purified Lppr5 by SEC coupled with MALS detection

    • Determine absolute molecular weight independent of shape

    • Identify different oligomeric species and their relative abundance

  • Analytical ultracentrifugation:

    • Perform sedimentation velocity and equilibrium experiments

    • Calculate sedimentation coefficients and molecular weights

    • Determine association constants for oligomerization

  • Crosslinking studies:

    • Treat purified protein or membrane fractions with chemical crosslinkers

    • Analyze crosslinked products by SDS-PAGE and Western blotting

    • Identify specific oligomeric states

  • Membrane-based dimerization analysis:

    • Assess protein density-dependent dimerization on membrane surfaces

    • Utilize techniques similar to those applied for PIP5K, which demonstrates membrane-mediated dimerization that enhances catalytic efficiency

    • Employ fluorescence resonance energy transfer (FRET) between differentially labeled Lppr5 molecules

  • Single-molecule imaging approaches:

    • Apply direct single-molecule imaging to observe dimerization dynamics

    • Analyze cooperative recruitment to membrane surfaces

    • Determine effect of dimerization on catalytic activity

These approaches collectively provide a comprehensive analysis of Lppr5 oligomerization behavior and its functional significance.

How can the membrane association dynamics of Lppr5 be characterized?

Characterizing Lppr5 membrane association dynamics requires specialized techniques:

  • Fluorescence recovery after photobleaching (FRAP):

    • Express fluorescently tagged Lppr5 in mammalian cells

    • Photobleach a defined membrane region and monitor fluorescence recovery

    • Calculate diffusion coefficients and mobile/immobile fractions

  • Single-particle tracking:

    • Label Lppr5 with quantum dots or other bright, photostable fluorophores

    • Track individual molecules on the cell membrane over time

    • Determine diffusion characteristics and potential confinement zones

  • Membrane binding assays:

    • Prepare synthetic liposomes with defined lipid compositions

    • Measure binding of purified Lppr5 to these membranes

    • Determine lipid preferences and binding kinetics

  • Cooperative membrane binding analysis:

    • Assess whether Lppr5 exhibits cooperative binding to specific membrane components

    • Evaluate potential substrate-enhanced membrane recruitment, similar to PIP5K's cooperative binding to PI(4,5)P2 lipids

    • Quantify binding parameters through surface plasmon resonance or microscale thermophoresis

These approaches provide detailed insights into Lppr5's membrane association behavior, crucial for understanding its function in the cellular context.

What methodologies enable identification of Lppr5 binding partners and regulatory proteins?

Identifying Lppr5 interacting partners requires multiple complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged Lppr5 in mammalian cells

    • Perform mild lysis to preserve protein-protein interactions

    • Isolate Lppr5 complexes using affinity purification

    • Identify binding partners through mass spectrometry

    • Validate interactions through reciprocal pulldowns

  • Proximity labeling approaches:

    • Generate BioID or APEX2 fusion constructs with Lppr5

    • Express in cells and activate proximity labeling

    • Identify proteins in close proximity through streptavidin pulldown and mass spectrometry

  • Yeast two-hybrid screening:

    • Use cytoplasmic domains of Lppr5 as bait

    • Screen against tissue-specific cDNA libraries

    • Validate potential interactions through secondary assays

  • Co-immunoprecipitation studies:

    • Develop specific antibodies against Lppr5 or use epitope tags

    • Perform immunoprecipitation from tissue or cell lysates

    • Identify co-precipitating proteins through Western blotting or mass spectrometry

  • Functional validation:

    • Assess whether identified interactions affect Lppr5 activity

    • Determine if membrane recruitment is influenced by binding partners

    • Evaluate potential allosteric regulation mechanisms, similar to those observed for PIP5K

These approaches collectively enable comprehensive identification and characterization of the Lppr5 interactome.

How can CRISPR-Cas9 technology be optimized for Lppr5 gene editing in mouse models?

Optimizing CRISPR-Cas9 gene editing for Lppr5 requires careful consideration of several factors:

  • Guide RNA (gRNA) design:

    • Select target sites with minimal off-target potential

    • Design multiple gRNAs targeting different exons

    • Focus on catalytic domains to ensure functional disruption

    • Validate gRNA efficiency in cell culture before mouse model generation

  • Delivery method optimization:

    • For zygote injection: prepare ribonucleoprotein complexes of Cas9 protein and gRNA

    • For ES cell modification: use plasmid-based or lentiviral delivery systems

    • Optimize concentration ratios of Cas9 to gRNA

  • Homology-directed repair (HDR) template design:

    • For knock-in modifications, design HDR templates with appropriate homology arms

    • Include selection markers flanked by recombination sites for subsequent removal

    • Incorporate silent mutations in the PAM site to prevent re-cutting

  • Validation strategies:

    • Design PCR genotyping assays spanning the target region

    • Develop sequencing strategies to confirm precise edits

    • Establish Western blotting protocols using specific antibodies

    • Quantify mRNA levels through RT-PCR using appropriately designed primers

  • Phenotypic characterization:

    • Develop tissue-specific assays focused on lipid metabolism

    • Analyze membrane composition in affected tissues

    • Assess neural development and function if targeting brain-expressed Lppr5

This comprehensive approach ensures generation of reliable mouse models for studying Lppr5 function.

What strategies effectively overcome expression challenges when producing Lppr5 for structural studies?

Structural studies of membrane proteins like Lppr5 present unique challenges requiring specialized approaches:

  • Expression construct optimization:

    • Test multiple construct designs with varying N- and C-terminal boundaries

    • Incorporate fusion partners (SUMO, MBP, or thermostabilized proteins)

    • Include cleavable purification tags positioned to minimize structural interference

    • Create chimeric constructs with structurally characterized homologs

  • Host system selection:

    • Evaluate insect cell (Sf9, High Five) expression for higher yields

    • Consider specialized mammalian cell lines (GnTI- HEK293) for glycoengineering

    • Test methylotrophic yeast systems for cost-effective scale-up

  • Protein stabilization strategies:

    • Screen detergent and lipid combinations systematically

    • Identify stabilizing ligands or inhibitors

    • Apply directed evolution or consensus mutagenesis approaches

    • Utilize nanodiscs or SMALPs for detergent-free preparation

  • Crystallization strategies:

    • Implement lipidic cubic phase crystallization

    • Screen antibody fragments as crystallization chaperones

    • Apply surface entropy reduction mutagenesis

    • Consider in situ proteolysis during crystallization

  • Cryo-EM considerations:

    • Optimize protein concentration and grid preparation protocols

    • Select appropriate grid types and vitrification conditions

    • Consider GraFix or chemical crosslinking for particle stability

This multi-faceted approach addresses the significant challenges associated with membrane protein structural studies, potentially yielding insights into Lppr5's mechanism of action.

How can recombinant Lppr5 be utilized to develop selective inhibitors for research applications?

Developing selective Lppr5 inhibitors for research purposes involves several strategic approaches:

  • High-throughput screening platform development:

    • Establish robust enzymatic assays compatible with microplate format

    • Optimize signal-to-noise ratio and Z' factor for screening reliability

    • Develop fluorescence-based or coupled enzyme assays for real-time monitoring

  • Structure-based inhibitor design:

    • Utilize homology models based on related phosphatases

    • Identify catalytic site residues and potential allosteric sites

    • Perform virtual screening against these sites

    • Design competitive inhibitors that mimic transition states

  • Fragment-based drug discovery:

    • Screen fragment libraries against purified Lppr5

    • Identify binding fragments through NMR, thermal shift assays, or surface plasmon resonance

    • Elaborate fragments through medicinal chemistry

    • Link fragments binding to adjacent sites

  • Inhibitor validation protocol:

    • Determine inhibition mechanism (competitive, noncompetitive, uncompetitive)

    • Measure IC50 and Ki values under standardized conditions

    • Assess selectivity against related phosphatases

    • Evaluate cell permeability and stability

    • Test effects in cellular systems expressing Lppr5

  • Development of tool compounds:

    • Generate photoaffinity probes for binding site identification

    • Create fluorescent probes for localization studies

    • Develop activity-based probes for monitoring enzyme activity in complex samples

This systematic approach enables development of selective research tools for investigating Lppr5 function in various biological contexts.

What strategies address the problem of low yield during recombinant Lppr5 expression?

Low expression yield is a common challenge with membrane proteins like Lppr5. Several strategies can address this issue:

  • Expression vector optimization:

    • Test different promoters (CMV, EF1α, CAG) for optimal expression level

    • Incorporate species-optimized codon usage

    • Include enhancer elements and optimal Kozak sequence

    • Evaluate different vector backbones for stability and copy number

  • Cell culture condition optimization:

    • Reduce culture temperature to 30-32°C during expression phase

    • Supplement medium with chemical chaperones (4-PBA, DMSO, glycerol)

    • Implement fed-batch cultivation to maintain nutrient levels

    • Test different cell densities at time of induction

  • Co-expression strategies:

    • Co-express molecular chaperones (BiP, calnexin, calreticulin)

    • Include relevant binding partners to stabilize the target protein

    • Co-express sigma factors or transcription enhancers

  • Induction protocol refinement:

    • Optimize inducer concentration and timing

    • Implement gradual induction protocols

    • Test pulse-induction strategies

  • Cell line selection:

    • Screen multiple cell lines (HEK293, CHO, ExpiCHO, Expi293)

    • Generate stable cell lines through antibiotic selection

    • Consider specialized cell lines engineered for membrane protein expression

These approaches collectively address various factors limiting recombinant protein yield and can significantly improve Lppr5 production.

How can researchers troubleshoot loss of enzymatic activity during purification of recombinant Lppr5?

Activity loss during purification is a critical challenge requiring systematic troubleshooting:

  • Buffer optimization:

    • Screen pH range (typically 6.5-8.5) to identify optimal stability conditions

    • Test various buffer systems (HEPES, Tris, phosphate) for compatibility

    • Include stabilizing additives (glycerol 10-20%, specific lipids, reducing agents)

    • Optimize ionic strength to maintain protein-lipid interactions

  • Detergent selection strategy:

    • Systematically screen detergent types (maltoside, glucoside, fos-choline series)

    • Evaluate detergent concentration effects on activity

    • Test mixed micelle systems with cholesterol or specific phospholipids

    • Consider detergent exchange during purification process

  • Protein oxidation prevention:

    • Maintain reducing environment with DTT or TCEP

    • Perform purification under nitrogen atmosphere for sensitive preparations

    • Include oxygen scavengers in buffers

    • Identify and mutate non-essential, oxidation-prone cysteine residues

  • Time and temperature management:

    • Minimize purification duration through optimized protocols

    • Maintain low temperature (4°C) throughout process

    • Avoid freeze-thaw cycles; instead, aliquot and flash-freeze samples

    • Consider stability-enhancing mutations based on homology modeling

  • Activity assay optimization:

    • Develop assays with physiologically relevant substrates and conditions

    • Include appropriate activators or cofactors in activity measurements

    • Validate assay using partially purified enzyme as positive control

This comprehensive troubleshooting approach addresses the complex factors affecting Lppr5 activity retention during purification.

What are the most effective approaches for generating and validating anti-Lppr5 antibodies for research applications?

Generating reliable antibodies against membrane proteins like Lppr5 requires specialized approaches:

  • Antigen design strategies:

    • Design multiple antigenic peptides from extracellular or cytoplasmic domains

    • Express and purify full-length protein in mammalian systems

    • Develop recombinant fragments corresponding to soluble domains

    • Consider KLH-conjugated synthetic peptides for increased immunogenicity

  • Immunization protocol:

    • Immunize mice with purified proteins in complete Freund's adjuvant

    • Follow with multiple boosts using incomplete Freund's adjuvant

    • Monitor antibody titer through ELISA before final boost

    • Use multiple antigen presentation formats (proteins, peptides, DNA vaccines)

  • Hybridoma selection workflow:

    • Harvest splenocytes from immunized mice

    • Fuse with appropriate myeloma cells using PEG-mediated fusion

    • Culture in HAT selection medium to eliminate unfused myeloma cells

    • Screen hybridoma supernatants using multiple methods

  • Validation strategy:

    • Confirm specificity through Western blotting against recombinant protein

    • Test cross-reactivity with related proteins

    • Validate using tissues from knockout models as negative controls

    • Confirm utility in multiple applications (immunohistochemistry, immunoprecipitation)

    • Evaluate epitope accessibility in native vs. denatured conditions

  • Recombinant antibody optimization:

    • Clone antibody variable regions from selected hybridomas

    • Express as recombinant fragments (Fab, scFv) or full IgG

    • Engineer for improved affinity or specificity if needed

    • Develop fusion constructs for specialized applications

This comprehensive approach yields well-characterized antibodies suitable for diverse research applications.

What statistical approaches are most appropriate for analyzing Lppr5 enzymatic activity data?

Appropriate statistical analysis of Lppr5 enzymatic data requires specialized approaches:

  • Enzyme kinetics analysis:

    • Fit initial velocity data to appropriate models (Michaelis-Menten, Hill equation)

    • Calculate kinetic parameters (Km, Vmax, kcat, Hill coefficient)

    • Apply nonlinear regression with proper weighting

    • Perform global fitting for complex kinetic mechanisms

    • Compare nested models using F-test or AIC/BIC criteria

  • Comparative statistical analysis:

    • Apply paired t-tests for comparing activity under different conditions

    • Use ANOVA with appropriate post-hoc tests for multiple condition comparisons

    • Implement non-parametric tests when normality assumptions are violated

    • Calculate effect sizes to quantify biological significance

  • Variability assessment:

    • Analyze sources of experimental variation through variance component analysis

    • Implement mixed-effects models to account for batch effects

    • Calculate coefficients of variation for method validation

    • Perform power analysis to determine required sample sizes

  • Time-series analysis for stability studies:

    • Apply regression analysis to quantify activity decay rates

    • Calculate half-life under various storage conditions

    • Use accelerated stability models to predict long-term stability

    • Implement multivariate analysis for complex stability datasets

How should researchers interpret apparent contradictions in Lppr5 localization or activity data?

Resolving contradictory data requires systematic analysis:

  • Technical variation assessment:

    • Evaluate methodology differences between contradictory studies

    • Assess antibody specificity and potential cross-reactivity

    • Consider cell/tissue type differences and their impact on localization

    • Analyze protein tagging strategies and potential interference with function

  • Biological variation analysis:

    • Determine if contradictions reflect true biological variability

    • Consider developmental stage, tissue specificity, or pathological context

    • Evaluate splice variant expression that might exhibit different properties

    • Assess post-translational modifications affecting localization or activity

  • Context-dependent effect analysis:

    • Investigate membrane composition differences between experimental systems

    • Evaluate potential binding partners present in different contexts

    • Consider regulatory mechanisms active in different physiological states

    • Analyze lipid environment variations that might affect membrane association

  • Methodological synthesis approach:

    • Design experiments that directly address contradictions

    • Implement multiple complementary techniques in the same study

    • Develop quantitative assays with appropriate controls

    • Perform systematic literature review and meta-analysis of available data

  • Computational modeling:

    • Develop models incorporating contextual factors

    • Simulate different experimental conditions

    • Identify parameters that could explain observed variations

    • Generate testable hypotheses to resolve contradictions

This structured approach transforms apparent contradictions into opportunities for deeper mechanistic understanding of Lppr5 function.

What emerging technologies hold promise for elucidating Lppr5 function in complex neural tissues?

Several cutting-edge technologies offer new opportunities for Lppr5 research:

  • Advanced spatial transcriptomics:

    • Apply single-cell RNA sequencing combined with spatial mapping

    • Identify cell-type specific expression patterns in neural tissues

    • Correlate Lppr5 expression with other genes in specific microenvironments

    • Map expression changes during development or pathological conditions

  • Optogenetic and chemogenetic approaches:

    • Develop light-sensitive Lppr5 variants for activity control

    • Create chemically-inducible dimerization systems to regulate Lppr5 localization

    • Implement targeted degradation approaches for temporal control

    • Apply these tools to study acute versus chronic loss of function

  • Super-resolution microscopy techniques:

    • Utilize STORM/PALM to visualize Lppr5 nanoscale organization

    • Apply expansion microscopy for improved spatial resolution

    • Implement live-cell super-resolution imaging to track dynamics

    • Combine with proximity labeling for in situ interaction mapping

  • Cryo-electron tomography:

    • Visualize Lppr5 in its native membrane environment

    • Analyze structural organization in cellular context

    • Determine relationship with other membrane components

    • Study conformational states under different conditions

  • Advanced genetic models:

    • Generate conditional and inducible knockout models

    • Develop knock-in reporter lines for live imaging

    • Create allelic series to study structure-function relationships

    • Implement tissue-specific CRISPR screens to identify genetic interactors

These technologies collectively offer unprecedented insights into Lppr5 function in complex neural tissues, potentially revealing new therapeutic targets.

How can systems biology approaches enhance understanding of Lppr5 regulatory networks?

Systems biology offers powerful frameworks for understanding Lppr5 in broader cellular contexts:

  • Multi-omics integration strategies:

    • Combine proteomics, lipidomics, and transcriptomics data

    • Develop integrated models of lipid metabolism networks

    • Identify regulatory hubs and feedback mechanisms

    • Predict system-wide effects of Lppr5 perturbation

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on Lppr5

    • Apply graph theory to identify network motifs and modules

    • Implement dynamic network analysis to capture temporal aspects

    • Develop predictive models of pathway crosstalk

  • Computational modeling:

    • Develop ordinary differential equation models of Lppr5-mediated processes

    • Implement stochastic simulations for low-abundance interactions

    • Create spatial models incorporating membrane dynamics

    • Validate models with targeted experimental perturbations

  • Machine learning applications:

    • Apply deep learning to predict Lppr5 interaction partners

    • Develop algorithms to identify regulatory patterns in multi-omics data

    • Implement feature selection to identify key regulatory nodes

    • Create predictive models of Lppr5 function in different cellular contexts

  • Comparative systems analysis:

    • Analyze Lppr5 networks across species to identify conserved modules

    • Compare different tissue contexts to identify tissue-specific regulation

    • Evaluate network perturbations in disease models

    • Identify potential therapeutic intervention points

These approaches provide a comprehensive framework for understanding Lppr5 function within the broader context of cellular regulatory networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.