Recombinant Mouse Lipid phosphate phosphohydrolase 2 (Ppap2c)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

Ppap2c exhibits broad substrate specificity, with the following catalytic efficiencies:

SubstrateRelative Catalytic Efficiency
Phosphatidic Acid (PA)Highest
Ceramide-1-Phosphate (C-1-P)Moderate
Lysophosphatidic Acid (LPA)Lower than PA
Sphingosine-1-Phosphate (S-1-P)Lowest

This Mg²⁺-independent enzyme operates optimally at neutral pH and is resistant to sulfhydryl reagents .

Tissue Distribution

  • High Expression: Lung, liver, and kidney .

  • Low Expression: Brain and heart .

Functional Insights

  • Lipid Signaling: By degrading bioactive lipids like LPA and S1P, Ppap2c regulates G-protein-coupled receptor (GPCR)-mediated signaling, influencing cell proliferation, migration, and apoptosis .

  • Knockout Phenotype: Mice lacking Ppap2c are viable and fertile, suggesting functional redundancy with other LPP isoforms (e.g., LPP1 and LPP3) .

Disease Relevance

  • Inflammation: While direct evidence is limited, studies on related isoforms (e.g., LPP3) suggest Ppap2c may modulate inflammatory responses by controlling extracellular lipid phosphate concentrations .

  • Vascular Function: Analogous to LPP3, Ppap2c could influence endothelial barrier integrity, though this requires experimental validation .

Applications in Research

Recombinant Ppap2c is utilized to:

  1. Investigate lipid phosphate metabolism in in vitro assays .

  2. Study cross-talk between phospholipase D (PLD) and PAP pathways .

  3. Explore mechanisms of lipid-mediated signal transduction in vascular and inflammatory models .

Production and Quality Control

  • Purity: Confirmed via SDS-PAGE and immunoblot .

  • Activity Assay: Validated using PA hydrolysis assays under Mg²⁺-free conditions .

  • Stability: Maintains activity for 12 months at -80°C; repeated freeze-thaw cycles are not recommended .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
Plpp2; Lpp2; Ppap2c; Phospholipid phosphatase 2; Lipid phosphate phosphohydrolase 2; PAP2-gamma; PAP2-G; Phosphatidate phosphohydrolase type 2c; Phosphatidic acid phosphatase 2c; PAP-2c; PAP2c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVILVSLGEAYLVYTDRLYSRSNFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSQVNCSGYVQLEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDHKHHWSDVLVGLLQGALVACLTVR YVSDFFKSRPPQPCQEDEVPERKPSLSLTLTLGDRP
Uniprot No.

Target Background

Function
Recombinant Mouse Lipid phosphate phosphohydrolase 2 (PPAP2C) is a magnesium-independent phospholipid phosphatase. It catalyzes the dephosphorylation of various glycerolipid and sphingolipid phosphate esters, including phosphatidate (PA), lysophosphatidate (LPA), sphingosine 1-phosphate (S1P), and ceramide 1-phosphate (C1P). Lacking apparent extracellular phosphatase activity, PPAP2C likely functions intracellularly. It also acts on N-oleoyl ethanolamine phosphate, a potential physiological compound. Through dephosphorylation of these bioactive lipid mediators, PPAP2C generates new bioactive compounds and potentially regulates signal transduction in diverse cellular processes. For instance, it indirectly modulates the cell cycle G1/S phase transition via its phospholipid phosphatase activity.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in lung, liver and kidney; at low levels in heart and brain, and was not detected in skeletal muscle.

Q&A

What is PLPP2/PPAP2C and what are its primary functions?

PLPP2 (formerly known as PPAP2C) is a member of the phosphatidic acid phosphatase (PAP) family. It catalyzes the dephosphorylation of phosphatidic acid (PtdOH) to produce diacylglycerol (DAG) and inorganic phosphate. This enzyme functions in two critical cellular processes: (1) de novo synthesis of glycerolipids and (2) receptor-activated signal transduction mediated by phospholipase D. PLPP2 belongs to the Mg²⁺-independent (PAP2) subfamily of these enzymes, distinguishing it mechanistically from the Mg²⁺-dependent PAP1 enzymes .

How does mouse PLPP2 differ structurally from human PLPP2?

Mouse PLPP2 shares significant sequence homology with its human ortholog but contains species-specific amino acid variations. Both proteins feature six transmembrane domains and a consensus N-glycosylation site. The catalytic regions that comprise the consensus sequences KxxxxxxRP (domain 1), PSGH (domain 2), and SRxxxxxHxxxD (domain 3) are highly conserved across species. These domains form the characteristic catalytic motif shared by the superfamily of lipid phosphatases that operate independently of Mg²⁺ ions .

What are the common aliases and identifiers for mouse PLPP2?

Mouse PLPP2 is referenced in literature and databases under several names and identifiers:

Alias/Identifier TypeDesignation
Gene SymbolPLPP2
Previous SymbolPPAP2C
Alternative NamesLipid phosphate phosphohydrolase 2, PAP-2c, PAP2-g
Homolog IdentifierHomoloGene: 2752
Mouse Gene IDMGI: 1354945

This nomenclature diversity reflects the evolving understanding of this enzyme's function and its reclassification within the lipid phosphatase family .

What expression systems are most effective for producing functional recombinant mouse PLPP2?

For membrane proteins like PLPP2 with multiple transmembrane domains, mammalian expression systems typically yield the most native-like functional protein. HEK293 or CHO cell lines are commonly used with inducible expression vectors containing appropriate signal sequences. Bacterial systems like E. coli can be used for functional studies of the catalytic domains, as demonstrated in functional assays for other PAP family enzymes. When using bacterial systems, fusion tags such as MBP (maltose-binding protein) can improve solubility and folding of the catalytic domains .

How can researchers optimize the purification of recombinant mouse PLPP2 while maintaining enzymatic activity?

Purification of functional PLPP2 requires careful consideration of its membrane-associated nature. A recommended protocol includes:

  • Expression in mammalian cells with a C-terminal purification tag (His6 or FLAG)

  • Gentle cell lysis using non-ionic detergents (0.5-1% Triton X-100 or n-dodecyl-β-D-maltoside)

  • Isolation of membrane fractions through differential centrifugation (100,000×g for 1 hour)

  • Solubilization of membrane proteins in detergent micelles

  • Affinity chromatography under mild conditions (4°C, pH 7.4)

  • Detergent exchange during purification to milder alternatives like 0.1% digitonin for final storage

Enzymatic activity should be monitored throughout purification since the transmembrane architecture is critical for maintaining proper folding and function of the catalytic domains .

What are the most reliable methods for measuring PLPP2 enzymatic activity?

PLPP2 activity can be measured using several complementary approaches:

  • Colorimetric phosphate release assay: Quantifies inorganic phosphate released from phosphatidic acid substrate using malachite green or other phosphate detection reagents.

  • Radiolabeled substrate assay: Uses ³²P-labeled phosphatidic acid to directly measure dephosphorylation by scintillation counting or TLC separation.

  • Fluorescent substrate assay: Utilizes fluorescent phosphatidic acid analogs to monitor activity through changes in fluorescence properties upon dephosphorylation.

For recombinant mouse PLPP2, the specific activity should be reported in μmol/min/mg protein, with typical values ranging from 5-20 μmol/min/mg for the purified enzyme under optimal conditions (pH 6.5-7.0, 37°C) .

How can researchers distinguish between PAP1 and PAP2 activities when characterizing recombinant mouse PLPP2?

Distinguishing between PAP1 and PAP2 activities is crucial for properly characterizing PLPP2:

ParameterPAP1 EnzymesPAP2 Enzymes (including PLPP2)
Mg²⁺ requirementDependentIndependent
N-ethylmaleimide (NEM) sensitivitySensitiveResistant
LocationCytosolic/peripheral membraneIntegral membrane protein
Substrate specificityPrimarily phosphatidic acidBroader - includes LPA, S1P, C1P
Triton X-100 effectStimulatedNot stimulated

To confirm PLPP2 (PAP2) activity, assays should be performed in the presence and absence of: (1) 2mM EDTA to chelate Mg²⁺, (2) 5mM NEM, and (3) varying Triton X-100 concentrations. PLPP2 activity should persist in conditions that inhibit PAP1 enzymes .

How does PLPP2 contribute to glycerolipid synthesis compared to other lipid synthesis pathways?

PLPP2 plays a significant role in the glycerol 3-phosphate pathway of lipid synthesis, which operates alongside the monoacylglycerol (2-MAG) pathway in tissues like intestine. In the glycerol 3-phosphate pathway, PLPP2 catalyzes the penultimate step by converting phosphatidic acid to diacylglycerol, which subsequently becomes the substrate for the synthesis of triacylglycerol (TAG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE).

In contrast, the 2-MAG pathway, which is prominent in intestinal lipid synthesis, bypasses the phosphatidic acid step by directly acylating monoacylglycerol. Studies suggest that while the 2-MAG pathway may predominate in intestinal TAG synthesis, the PLPP2-dependent glycerol 3-phosphate pathway appears more important for phospholipid synthesis required for cell membrane formation and proliferation .

What is the role of PLPP2 in cell signaling pathways?

PLPP2 functions as a critical regulator in phospholipid-mediated signaling cascades through multiple mechanisms:

  • Modulation of protein kinase C (PKC) activity: By generating diacylglycerol, PLPP2 provides a key activator of PKC isoforms, influencing cellular processes including proliferation, differentiation, and apoptosis.

  • Attenuation of phosphatidic acid signaling: PLPP2 can terminate phosphatidic acid-mediated signaling events by catalyzing its dephosphorylation, thereby affecting processes like vesicular trafficking, secretion, and endocytosis.

  • Regulation of phospholipase D signaling: In the phospholipase D and PAP pathway, PLPP2 helps control the balance between phosphatidic acid and diacylglycerol levels, fine-tuning downstream signaling outcomes.

This dual role in both generating (DAG) and degrading (phosphatidic acid) signaling lipids positions PLPP2 as a complex regulator of cellular communication networks .

What are the critical catalytic residues in mouse PLPP2 and how do mutations affect enzyme function?

The catalytic activity of mouse PLPP2 depends on conserved residues within three domains that form the active site:

  • Domain 1 (KxxxxxxRP): The conserved arginine residue is essential for substrate binding and orientation.

  • Domain 2 (PSGH): The histidine residue participates directly in the phosphate hydrolysis reaction.

  • Domain 3 (SRxxxxxHxxxD): Both the histidine and aspartic acid residues are critical for the catalytic mechanism.

Mutation studies have demonstrated that substitutions at these key residues (particularly the conserved histidines) can reduce enzymatic activity by >90%. For example, in homologous PAP2 enzymes, H→A mutations in domains 2 and 3, R→K mutations in domain 1, and D→N mutations in domain 3 all result in severely compromised catalytic efficiency while not affecting protein expression or membrane localization .

How do the transmembrane domains influence PLPP2 activity and substrate specificity?

The six transmembrane domains of PLPP2 serve multiple critical functions beyond membrane anchoring:

  • Active site positioning: The transmembrane architecture positions the catalytic residues optimally at the membrane-cytosol interface where they can access phospholipid substrates.

  • Substrate selection: The transmembrane domains create a hydrophobic pocket that accommodates the lipid portion of substrates, contributing to substrate specificity.

  • Conformational flexibility: The transmembrane regions allow for dynamic movement that facilitates enzyme-substrate interactions and product release.

Studies comparing full-length PLPP2 with truncated variants lacking certain transmembrane segments demonstrate that proper membrane topology is essential for maximal enzymatic activity. Disruption of this architecture typically results in substantial losses of activity even when the catalytic residues remain intact .

How can recombinant mouse PLPP2 be used to study lipid metabolism disorders?

Recombinant mouse PLPP2 serves as a valuable tool for investigating lipid metabolism disorders through multiple experimental approaches:

  • In vitro reconstitution systems: Purified recombinant PLPP2 can be incorporated into artificial membrane systems with defined lipid compositions to study enzymatic behavior under controlled conditions mimicking normal or pathological states.

  • Cell-based overexpression models: Transfection of recombinant PLPP2 (wild-type or mutant variants) into cultured cells allows for assessment of how altered PLPP2 activity impacts cellular lipid profiles, signaling pathways, and metabolic functions.

  • Enzyme replacement studies: In cell models derived from knockout animals or patient samples with PAP2 deficiencies, recombinant PLPP2 can be used to restore activity and evaluate functional rescue.

  • Inhibitor screening platforms: Purified recombinant PLPP2 facilitates high-throughput screening for small molecule modulators that could have therapeutic potential in conditions involving dysregulated lipid metabolism .

What are the most effective approaches for studying PLPP2 in mouse models?

Several complementary approaches have proven effective for studying PLPP2 function in vivo:

  • Conditional knockout models: Tissue-specific deletion of PLPP2 using Cre-loxP technology allows for evaluation of its function in specific contexts while avoiding potential embryonic lethality of global knockouts.

  • Transgenic overexpression: Tissue-specific or inducible overexpression of wild-type or mutant PLPP2 can reveal gain-of-function effects and tissue-specific roles.

  • AAV-mediated gene delivery: Adeno-associated viral vectors carrying PLPP2 constructs enable targeted expression in adult tissues, bypassing developmental adaptations.

  • CRISPR-Cas9 genome editing: Introduction of specific mutations in the endogenous PLPP2 gene allows for analysis of structure-function relationships under physiological expression control.

When designing these models, researchers should consider compensatory upregulation of related PAP family members (PLPP1 and PLPP3/PPAP2B) that may mask phenotypes in single-gene disruption models .

What are common challenges when working with recombinant mouse PLPP2 and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant PLPP2:

ChallengeSolution Approach
Low expression levelsOptimize codon usage for the expression system; use stronger promoters; consider fusion tags that enhance expression
Protein misfoldingExpress at lower temperatures (16-30°C); include chemical chaperones in the culture medium; use specialized host strains
Loss of activity during purificationInclude glycerol (10-20%) and reducing agents in all buffers; minimize purification steps; avoid freeze-thaw cycles
Inconsistent activity measurementsStandardize substrate preparation; control detergent concentrations carefully; include positive controls in each assay
Aggregation during storageStore at moderate protein concentrations (0.5-1 mg/ml) with glycerol; avoid repeated freeze-thaw cycles

Additionally, when working with the transmembrane form of PLPP2, maintain appropriate detergent concentrations above the critical micelle concentration throughout all experimental procedures to preserve the native structure .

How can researchers validate that recombinant mouse PLPP2 retains native functional properties?

Comprehensive validation of recombinant PLPP2 functionality should include:

  • Enzymatic parameter comparison: Determine Km and Vmax values for phosphatidic acid and compare with published values for the native enzyme (Km typically 10-50 μM for phosphatidic acid).

  • Substrate specificity profile: Test activity against multiple substrates (phosphatidic acid, lysophosphatidic acid, sphingosine-1-phosphate) and compare relative activities with established patterns.

  • Inhibitor sensitivity: Verify expected responses to known PAP2 inhibitors like propranolol (IC50 ~50-100 μM) and sphingosine (IC50 ~20-50 μM).

  • pH and temperature optima: Confirm that recombinant PLPP2 exhibits maximal activity under physiological conditions (pH 6.5-7.5, 37°C) similar to the native enzyme.

  • Post-translational modifications: Verify glycosylation status using glycosidase treatments and Western blotting, as N-glycosylation can influence enzyme stability and activity .

How can recombinant mouse PLPP2 be utilized to investigate mitochondrial dysfunction and cardiac disorders?

While PLPP2 itself is not localized to mitochondria, its role in lipid metabolism intersects with mitochondrial function. Research approaches include:

  • Lipid composition analysis: Use recombinant PLPP2 in reconstitution experiments to study how altered phospholipid metabolism affects mitochondrial membrane composition and function.

  • Comparative studies with PPA2: Investigate potential functional relationships between cytosolic/ER-localized PLPP2 and mitochondrial pyrophosphatase (PPA2), as defects in the latter have been linked to sudden cardiac death and cardiomyopathy.

  • Cardiolipin precursor metabolism: Examine how PLPP2-mediated phosphatidic acid metabolism influences the availability of precursors for cardiolipin synthesis, a critical mitochondrial phospholipid for cardiac function.

  • Cellular stress models: Deploy recombinant PLPP2 in cellular systems to investigate how modulation of its activity impacts cardiac cell responses to stressors like alcohol exposure or hypoxia, which have been identified as triggers for cardiac events in patients with mitochondrial phosphatase deficiencies .

What emerging technologies are advancing our understanding of PLPP2 structure-function relationships?

Several cutting-edge approaches are enhancing our understanding of PLPP2:

  • Cryo-electron microscopy: This technique is beginning to overcome historical challenges in membrane protein structural determination, potentially revealing precise structural arrangements of PLPP2's transmembrane domains and catalytic site.

  • Native mass spectrometry: Enabling analysis of membrane proteins within detergent micelles or nanodiscs, this technique can provide insights into PLPP2 interactions with lipids and potential protein partners.

  • APEX2 proximity labeling: By fusing PLPP2 with engineered ascorbate peroxidase, researchers can identify proximal proteins in living cells, mapping the PLPP2 interactome with spatiotemporal precision.

  • Optogenetic control of enzyme activity: Light-responsive domains engineered into recombinant PLPP2 allow for precise temporal control of its activity, enabling studies of acute versus chronic effects of altered phosphatidic acid metabolism.

  • Single-molecule tracking: Advanced microscopy techniques permit visualization of individual PLPP2 molecules in cellular membranes, revealing dynamics of enzyme movement, clustering, and potential entry into specialized membrane domains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.