Recombinant Mouse Lipid phosphate phosphohydrolase 3 (Ppap2b)

Shipped with Ice Packs
In Stock

Description

Role in Vascular Integrity

  • Endothelial barrier regulation: Mice lacking endothelial Ppap2b exhibit increased vascular permeability and exaggerated inflammatory responses to LPS, highlighting LPP3's role in maintaining barrier function .

  • Mechanism: Recombinant LPP3 counteracts autotaxin-generated LPA signaling, which promotes vascular leak via LPA receptors (e.g., LPA1/2) .

Therapeutic Relevance

  • Coronary artery disease: A common PPAP2B polymorphism in humans is linked to increased cardiovascular risk, making recombinant mouse LPP3 a tool for studying this association .

  • Inflammatory modulation: Inhibiting LPA signaling with recombinant LPP3 reduces endothelial permeability in murine models of sepsis .

Experimental Applications

  • Enzyme kinetics: Used to measure catalytic efficiency (KmK_m and VmaxV_{max}) for LPA/S1P substrates .

  • Drug discovery: Screens for autotaxin or LPA receptor inhibitors often include recombinant LPP3 to validate target specificity .

  • Structural studies: Facilitates crystallography and mutagenesis experiments to map active-site residues .

Limitations and Considerations

  • Species specificity: Mouse recombinant LPP3 shares ~85% amino acid identity with human LPP3, necessitating caution in translational studies .

  • Post-translational modifications: Glycosylation patterns vary between expression systems, potentially affecting activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please communicate your preference. We will prioritize developing the specified tag.
Synonyms
Plpp3; Lpp3; Ppap2b; Phospholipid phosphatase 3; Lipid phosphate phosphohydrolase 3; PAP2-beta; Phosphatidate phosphohydrolase type 2b; Phosphatidic acid phosphatase 2b; PAP-2b; PAP2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPV DIIDRNNHHNMV
Uniprot No.

Target Background

Function
Lipid phosphate phosphohydrolase 3 (PLPP3), also known as Phosphatidic acid phosphatase type 2B (PPAP2B), is a magnesium-independent phospholipid phosphatase located on the plasma membrane. It catalyzes the dephosphorylation of various glycerolipid and sphingolipid phosphate esters, including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P, and ceramide 1-phosphate/C1P. Additionally, it acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound. PLPP3 exhibits both extracellular and intracellular phosphatase activity, enabling the hydrolysis and cellular uptake of these bioactive lipid mediators from the surrounding environment, thereby regulating signal transduction in diverse cellular processes.
Through the dephosphorylation of extracellular sphingosine-1-phosphate and the regulation of its extra- and intracellular availability, PLPP3 plays a crucial role in vascular homeostasis. It modulates endothelial cell migration, adhesion, survival, proliferation, and the production of pro-inflammatory cytokines. Maintaining the appropriate levels of this lipid in the cerebellum ensures proper cerebellar development and function.
By its intracellular lipid phosphatase activity, PLPP3 may function in early compartments of the secretory pathway, regulating the formation of Golgi to endoplasmic reticulum retrograde transport carriers. Independently of its phosphatase activity, PLPP3 might also be involved in the Wnt signaling pathway and the stabilization of beta-catenin/CTNNB1, thereby regulating cell proliferation, migration, and differentiation in angiogenesis or tumor growth. It also contributes to integrin-mediated cell-cell adhesion during angiogenesis.
Gene References Into Functions
  1. Lipid phosphate phosphatase 3 regulates adipocyte sphingolipid synthesis, but not developmental adipogenesis or diet-induced obesity in mice PMID: 29889835
  2. Plpp3 ablation in mice worsened atherosclerosis development. Lipidomic analysis suggested that the hepatic Plpp3 deletion may promote atherosclerosis by increasing plasma levels of several low-abundant pro-atherogenic lipids, thus providing a molecular basis for the observed results. PMID: 28291223
  3. Lack of PLPP3 results in deteriorating cardiac function. PMID: 28982073
  4. Demonstrate essential roles of LPP3 in the maturation of endothelial cell barrier integrity and normal cardiovascular development. PMID: 27125875
  5. Mechanosensitive PPAP2B plays a critical role in promoting anti-inflammatory phenotype and maintaining vascular integrity of endothelial monolayer under atheroprotective flow. PMID: 26034042
  6. Results identify a role for the autotaxin/LPA-signaling nexus as a mediator of endothelial permeability in inflammation and demonstrate that LPP3 limits these effects. PMID: 24504738
  7. LPP3 serves as an intrinsic negative regulator of smooth muscle cell phenotypic modulation and inflammation after vascular injury, in part, by regulating lysophospholipid signaling. PMID: 23104851
  8. Our data show that LPP3 plays a fundamental role during spinal neuron differentiation from embryonic stem cells and that it also participates in regulating neurite and axon outgrowth. PMID: 22434721
  9. generation and destruction are tightly regulated and LPP3 is essential to establish the balance PMID: 21576386
  10. Altogether our data indicate that LPP3 participates in several aspects of neuron-glia communication required for proper cerebellum development. PMID: 21319224
  11. Data show that mouse embryos deficient for lipid phosphate phosphatase 3 fail to form a chorio-allantoic placenta and yolk sac vasculature. PMID: 12925589
  12. provide a mechanism for the function of LPP3 in cell-cell interactions in both human and mouse PMID: 16099422
  13. Targeted inactivation results in embryonic lethality because of defects in extraembryonic vascular development and gastrulation. PMID: 17610274
  14. Lpp3 expression may play a key role in modulating/integrating multiple signaling pathways during development PMID: 19123136

Show More

Hide All

Database Links
Involvement In Disease
Ppap2b deficient embryos fail to form a chorioallantoic placenta and yolk sac vasculature. A subset of embryos also show a shortening of the anterior-posterior axis and frequent duplication of axial structures. Loss of Ppap2b results in a marked increase in beta-catenin-mediated T-cell factor (TCF) transcription.
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.
Tissue Specificity
Detected in lung, cerebellum and heart atrium.

Q&A

What is Lipid Phosphate Phosphohydrolase 3 (LPP3) and how does it function biochemically?

Lipid phosphate phosphohydrolase 3 (LPP3) is an integral membrane glycoprotein encoded by the Ppap2b gene in mice (PPAP2B in humans). It belongs to a family of enzymes that were initially identified as phosphatidic acid phosphatases but have subsequently been shown to dephosphorylate a broader range of lipid substrates . LPP3 functions by dephosphorylating bioactive lipid mediators including lysophosphatidic acid (LPA), ceramide-1-phosphate, sphingosine-1-phosphate (S1P), and diacylglycerol pyrophosphate .

From a structural perspective, LPP3 has a predicted topology consisting of six transmembrane domains with an active site located on the extracellular or luminal surface of the membrane . This positioning is crucial for its function in terminating extracellular signaling of bioactive lipids by dephosphorylating them, which prevents their activation of G-protein-coupled receptors .

How does LPP3 differ from other lipid phosphate phosphatases (LPP1 and LPP2)?

In mammals, three LPP enzymes have been identified: LPP1, LPP2, and LPP3, which are encoded by the PPAP2A, PPAP2C, and PPAP2B genes, respectively . While these enzymes display essentially identical enzymatic activities in vitro and have overlapping expression patterns in adult tissues, they are not functionally redundant during development .

The key difference lies in their physiological significance: loss of Ppap2c (encoding LPP2) and gene-trap inactivation of Ppap2a (encoding LPP1) in mice does not result in phenotypic alterations, although circulating LPA levels may be lower in the latter animals . In stark contrast, global deletion of Ppap2b (encoding LPP3) in mice results in embryonic lethality, primarily due to defects in extraembryonic vascular development . This indicates that despite their biochemical similarities, LPP3 performs unique and essential functions that cannot be compensated for by other LPP family members.

What role does Ppap2b play in vascular development?

Ppap2b plays a critical and non-redundant role in vascular development. Studies have demonstrated that targeted deletion of Ppap2b results in embryonic lethality due to severe vascular defects . More specifically, when Ppap2b is inactivated using Tyrosine kinase Tek (Tie2) promoter-mediated Cre expression, which targets both endothelial and hematopoietic cells, embryonic lethality occurs due to failure of normal vascular formation .

Detailed analysis reveals that Tie2-Ppap2bΔ embryos (with Ppap2b deleted in Tie2-expressing cells) share many features observed in embryos globally lacking Ppap2b . Embryos with Tie2-Cre mediated deletion of Ppap2b follow normal Mendelian distribution at E9.5 and E10.5, but no viable embryos are identified after E12.5, confirming the critical developmental window during which LPP3 function is essential .

Furthermore, in adult mice with tamoxifen-inducible Ppap2b deletion, neovascularization is impaired. Specifically, vessels that form in Matrigel implants in these mice are smaller, and fewer vessels form in the center of the plugs compared to control mice (P<0.001) . This finding is consistent with previous reports that antibodies to LPP3 inhibited capillary morphogenesis in vitro .

What mouse models are available for studying Ppap2b function?

Several mouse models have been developed to study Ppap2b function in various contexts:

  • Global Ppap2b knockout mice: These mice exhibit embryonic lethality due to defects in extraembryonic vascular development, highlighting the essential role of LPP3 in development .

  • Conditional Ppap2b knockout using Tie2-Cre (Tie2-Ppap2bΔ): This model targets deletion in both endothelial and hematopoietic cells. These mice display embryonic lethality similar to global knockouts, with no viable embryos identified after E12.5 .

  • Inducible endothelial and hematopoietic Ppap2b deletion (ERT2-Ppap2bΔ): Generated by crossing Ppap2b floxed mice with transgenic mice expressing a recombinant estrogen receptor-Cre fusion protein under the control of the Tie2 promoter. Administration of tamoxifen activates Cre recombinase, allowing for temporal control of Ppap2b deletion .

  • Chimeric mice: Created through bone marrow transplantation between Ppap2b floxed and ERT2-Ppap2bΔ mice, these models help distinguish between the roles of LPP3 in endothelial versus hematopoietic cells .

Each of these models offers specific advantages for investigating different aspects of LPP3 function in developmental or adult contexts.

How can Ppap2b expression and activity be reliably measured in experimental settings?

Measuring Ppap2b expression and activity in experimental settings requires a combination of techniques targeting both gene and protein levels, as well as enzymatic activity:

  • mRNA expression: Quantitative PCR can be used to measure Ppap2b mRNA levels relative to other genes, such as Ppap2a and Ppap2c. In studies with ERT2-Ppap2bΔ mice, Ppap2b mRNA levels were approximately 2-fold lower in lungs compared to control mice, while no differences were observed in Ppap2a or Ppap2c mRNA levels .

  • Protein expression: Immunoblot analysis using specific antibodies against LPP3 can determine protein levels. This approach confirmed reduced LPP3 levels in lung tissue from ERT2-Ppap2bΔ mice .

  • Immunohistochemistry/Immunofluorescence: These techniques can assess the presence or absence of LPP3 in specific cell types. For example, immunohistochemical analysis of lung tissue from ERT2-Ppap2bΔ mice confirmed the absence of LPP3 in endothelial cells but its retention in other cell types .

  • Lipid phosphatase activity assays: LPP3 enzymatic activity can be measured in immunoprecipitates. Studies have shown reduced lipid phosphatase activity in LPP3 immunoprecipitates from ERT2-Ppap2bΔ lungs .

  • Functional assays: For in vivo confirmation of LPP3 deletion, functional assays such as neovascularization in Matrigel implants can be employed, as demonstrated by studies showing smaller and fewer vessels in Matrigel plugs from ERT2-Ppap2bΔ mice .

What methods are effective for studying vascular permeability in Ppap2b-deficient models?

Several complementary methods have proven effective for studying vascular permeability in Ppap2b-deficient models:

  • Evans Blue Dye (EBD) accumulation assay: This technique measures vascular leak by quantifying the extravasation of albumin-bound Evans Blue dye into tissues. Studies have shown that LPP3 deficiency in ERT2-Ppap2bΔ mice resulted in a 2.2 ± 0.5-fold increase in basal vascular permeability in lungs compared to control mice .

  • Ventilated/perfused lung models: This ex vivo approach allows direct measurement of endothelial barrier function. In buffer-perfused lungs, LPS administered via the pulmonary artery increased EBD accumulation in lungs of both control and ERT2-Ppap2bΔ mice, with greater effects in the latter .

  • Chimeric mouse models: By creating bone marrow chimeras between Ppap2b-deficient and wild-type mice, researchers determined that the vascular barrier defect tracked with the absence of LPP3 in vascular (but not marrow) cells, confirming the critical role of endothelial LPP3 .

  • Pharmacological manipulation: The use of LPA signaling modulators (such as the autotaxin inhibitor PF8380 or the pan-LPA receptor antagonist BrP-LPA) in permeability assays helped establish that the increased permeability in Ppap2b-deficient mice was mediated by enhanced LPA signaling .

  • FITC-dextran visualization: For assessing vessel formation and permeability in Matrigel implants, intravenously administered FITC-dextran allows visualization and quantification of vessels by size (small [<10μm], medium [10–20μm], and large [>20μm]) .

How does LPP3 deficiency affect inflammatory responses in vivo?

LPP3 deficiency significantly enhances both local and systemic inflammatory responses in vivo through multiple mechanisms:

  • Increased leukocyte infiltration: ERT2-Ppap2bΔ mice show significantly more leukocyte infiltration into the peritoneum following thioglycolate administration compared to control mice . The infiltrating cells in these mice lack LPP3 expression, indicating successful deletion in the hematopoietic compartment .

  • Enhanced cytokine production: Following lipopolysaccharide (LPS) challenge, ERT2-Ppap2bΔ mice exhibit significantly higher plasma levels of inflammatory cytokines. Specifically, LPS-induced expression of IL-6 was 3.3 ± 0.5-fold higher and KC (mouse IL-8 homolog) was 1.9 ± 0.6-fold higher compared to LPS-treated control mice .

  • Altered cytokine profile: Cytokine antibody array analysis of plasma confirmed elevated IL-6 and KC levels in ERT2-Ppap2bΔ mice after LPS administration and further revealed increases in MIP-2 and RANTES. Interestingly, some cytokines (G-CSF, sICAM-1, M-CSF, and CXCL9) appeared lower than in control mice, suggesting a complex regulation of the inflammatory response by LPP3 .

  • Cell-specific contributions: Studies using liposomal-clondronate to deplete circulating monocytes showed that plasma IL-6 levels in ERT2-Ppap2bΔ mice were not affected by monocyte depletion prior to LPS administration, indicating that monocytes are not the primary source of enhanced IL-6 production in these mice .

What is the relationship between Ppap2b and vascular permeability?

Ppap2b plays a critical role in maintaining vascular barrier function, with its deficiency leading to significant increases in vascular permeability through several mechanisms:

  • Baseline barrier dysfunction: LPP3 deficiency in endothelial cells (ERT2-Ppap2bΔ mice) results in a 2.2 ± 0.5-fold increase in basal vascular permeability in the lungs even without inflammatory challenge .

  • Enhanced inflammation-induced permeability: Following LPS administration, ERT2-Ppap2bΔ mice experience significantly more vessel leak compared to control mice, indicating that LPP3 deficiency exacerbates inflammation-induced vascular permeability .

  • Endothelial-specific effect: Chimeric mouse studies demonstrated that the vascular barrier defect follows the genotype of the recipient mice (lacking LPP3 in vessels) and not the genotype of the transplanted marrow, confirming that endothelial, not hematopoietic, LPP3 is critical for maintaining barrier function .

  • LPA-mediated mechanism: The barrier dysfunction in LPP3-deficient mice appears to be mediated through enhanced LPA signaling rather than altered S1P signaling. Both pharmacological inhibition of LPA production (via the autotaxin inhibitor PF8380) and blockade of LPA receptors (using the pan-LPA receptor antagonist BrP-LPA) significantly reduced vascular permeability in ERT2-Ppap2bΔ mice .

  • Direct endothelial effects: Ex vivo experiments using ventilated/perfused lungs confirmed that the enhanced permeability occurs at the level of the endothelium, with LPS administered via the pulmonary artery increasing EBD accumulation to a greater extent in ERT2-Ppap2bΔ mice compared to controls .

What is the evidence linking PPAP2B polymorphisms to coronary artery disease in humans?

There is compelling genetic evidence linking PPAP2B polymorphisms to coronary artery disease (CAD) in humans:

  • Genome-wide association studies (GWAS): Two concurrently published GWAS identified polymorphisms in the final intron of PPAP2B that associate with increased risk for human coronary artery disease .

  • Meta-analysis confirmation: In a GWAS meta-analysis involving more than 86,000 individuals, the PPAP2B risk allele independently predicted CAD with an odds ratio of 1.17 (P = 3.81 × 10^-19) .

  • Independence from traditional risk factors: Importantly, the association between the PPAP2B polymorphism and CAD lacked association with traditional risk factors such as hypertension, cholesterol, diabetes, obesity, or smoking, suggesting a novel pathway to atherosclerosis .

  • Potential mechanism: While the exact mechanism by which the risk-associated polymorphism affects CAD risk is not fully understood, it may alter LPP3 expression or function, potentially affecting vascular inflammation or permeability based on the mouse studies described earlier .

This genetic evidence, combined with the functional studies in mice demonstrating LPP3's critical role in vascular development and function, strongly suggests that LPP3 is an important mediator of vascular health and disease in humans.

How can Ppap2b research contribute to understanding bioactive lipid signaling networks?

Ppap2b research provides crucial insights into bioactive lipid signaling networks through several important avenues:

  • Termination of lipid signaling: LPP3 dephosphorylates bioactive lipids like LPA and S1P, effectively terminating their G-protein-coupled receptor (GPCR)-mediated signaling. Understanding this mechanism helps elucidate how lipid signaling pathways are regulated temporally and spatially .

  • Differential regulation of multiple lipid mediators: While LPP3 can dephosphorylate both LPA and S1P, research on Ppap2b-deficient models reveals distinct patterns of dysregulation. For instance, the vascular permeability phenotype in LPP3-deficient mice appears to be mediated primarily through enhanced LPA signaling rather than altered S1P effects . This differential regulation provides insight into the complex interplay between different bioactive lipid pathways.

  • Cell-specific signaling contexts: Research using conditional Ppap2b knockout models demonstrates that LPP3's role in lipid signaling networks can be highly cell-type specific. For example, endothelial LPP3 deficiency, but not hematopoietic deficiency, leads to increased vascular permeability . This indicates that the same enzyme can have different functions in the lipid signaling network depending on cellular context.

  • Cross-talk with inflammatory pathways: Studies showing enhanced inflammatory responses in LPP3-deficient mice reveal important interactions between bioactive lipid signaling and inflammatory cascades . This cross-talk is essential for understanding how lipid mediators contribute to inflammatory conditions.

What techniques can be used to distinguish between enzymatic and non-enzymatic functions of LPP3?

Distinguishing between enzymatic and non-enzymatic functions of LPP3 requires sophisticated experimental approaches:

What are the potential therapeutic implications of targeting Ppap2b pathways in vascular diseases?

Research on Ppap2b reveals several promising therapeutic avenues for vascular diseases:

  • Enhancing LPP3 activity or expression: Given that PPAP2B polymorphisms are associated with increased risk of coronary artery disease in humans , strategies to enhance LPP3 activity or expression could potentially reduce cardiovascular risk. This might be achieved through gene therapy approaches or by identifying compounds that increase PPAP2B transcription or LPP3 activity.

  • Targeting downstream LPA signaling: Studies demonstrating that LPP3 deficiency leads to enhanced LPA signaling and increased vascular permeability suggest that LPA receptor antagonists might be therapeutic in certain vascular conditions . Indeed, the pan-LPA receptor antagonist BrP-LPA reduced vascular permeability in LPP3-deficient mice , indicating potential clinical utility.

  • Inhibiting LPA production: Another approach suggested by LPP3 research is to target autotaxin, the enzyme responsible for producing bioactive LPA. In LPP3-deficient mice, the autotaxin inhibitor PF8380 decreased plasma LPA levels and reduced vascular permeability in response to LPS , pointing to a potential therapeutic strategy.

  • Cell-targeted approaches: The finding that endothelial, but not hematopoietic, LPP3 is critical for maintaining vascular barrier function suggests that endothelial-targeted therapies might be particularly effective for vascular leak syndromes .

  • Combination with S1P-targeted therapies: While S1P receptor modulation did not appear to be the primary mechanism for the vascular leak in LPP3-deficient mice, S1P was still able to enhance barrier function in these animals . This suggests potential for combination therapies targeting both LPA and S1P pathways in conditions characterized by vascular dysfunction.

How should researchers address variability in Ppap2b phenotypes across different mouse strains?

Addressing variability in Ppap2b phenotypes across different mouse strains requires systematic approaches:

  • Backcrossing strategy: When variability is observed, researchers should consider backcrossing the Ppap2b mutations onto a pure genetic background (e.g., C57BL/6 or 129/Sv) for at least 8-10 generations to minimize strain-specific effects. The search results indicate that mating experiments with Tie2-Ppap2b mice were conducted "on either a mixed B6/129 or pure background" , suggesting awareness of potential strain effects.

  • Use of littermate controls: Always use littermate controls from the same breeding pairs to minimize genetic background differences. This is particularly important when working with mixed genetic backgrounds.

  • Strain documentation and reporting: Accurately document and report the exact strain background in publications. Consider stating the percentage of each background strain if working with mixed backgrounds (e.g., 75% C57BL/6, 25% 129/Sv).

  • Parallel studies in multiple strains: For key findings, consider validating results in at least two different pure genetic backgrounds to determine which phenotypes are consistent across strains versus strain-specific.

  • Control for modifier genes: If specific modifier genes are known to affect the phenotype of interest, genotype for these loci and incorporate this information into the analysis.

  • Statistical approaches: Employ statistical methods that can account for strain background as a variable in the analysis, particularly when working with mixed backgrounds or comparing across different strains.

What controls are critical when studying inflammatory responses in Ppap2b-deficient models?

When studying inflammatory responses in Ppap2b-deficient models, several critical controls should be implemented:

  • Proper genetic controls: Use littermate Ppap2b^fl/fl mice that have received the same tamoxifen treatment as the experimental ERT2-Ppap2b^Δ mice to control for tamoxifen effects . In the case of bone marrow chimeras, include all relevant combinations of donor and recipient genotypes .

  • Validation of Ppap2b deletion: Confirm successful deletion of Ppap2b at both mRNA and protein levels in the relevant tissues and cell types. The studies in the search results utilized qPCR, immunoblotting, and immunohistochemistry to verify LPP3 deficiency .

  • Assessment of compensatory mechanisms: Measure expression levels of other LPP family members (Ppap2a and Ppap2c) to check for potential compensatory upregulation, as was done in the reported studies .

  • Baseline inflammatory markers: Establish baseline levels of inflammatory markers (cytokines, leukocyte counts) prior to any challenge to determine if LPP3 deficiency alone causes inflammation .

  • Dose-response relationships: Test multiple doses of inflammatory stimuli (e.g., LPS, thioglycolate) to establish dose-response relationships and identify potential threshold effects .

  • Time course studies: Examine inflammatory responses at multiple time points to capture both early and late effects of LPP3 deficiency on inflammation.

  • Cell-specific contributions: Use approaches like selective depletion of specific cell populations (e.g., liposomal-clondronate for monocytes) to determine which cell types contribute to the enhanced inflammatory response, as was done in the reported studies .

  • Pharmacological validation: Use pharmacological agents targeting specific pathways (e.g., LPA signaling) to confirm the mechanistic basis of the enhanced inflammatory response in LPP3-deficient models .

How can researchers differentiate LPP3-specific effects from those caused by alterations in lysophosphatidic acid or sphingosine-1-phosphate signaling?

Differentiating LPP3-specific effects from those caused by alterations in LPA or S1P signaling requires multiple complementary approaches:

  • Comparative receptor expression analysis: Quantify the expression levels of LPA and S1P receptors in tissues from Ppap2b-deficient and control mice to determine if receptor expression is altered. The studies in the search results assessed S1P receptor 1 (S1PR1) expression on lymphocytes using flow cytometry and found no difference between genotypes .

  • Functional response to exogenous mediators: Test the responsiveness of Ppap2b-deficient and control tissues/cells to exogenous LPA and S1P. In the reported studies, S1P was able to enhance barrier function following LPS administration in both control and LPP3-deficient mice, suggesting that S1P receptor signaling remained intact .

  • Measurement of bioactive lipid levels: Quantify LPA and S1P levels in plasma and tissues from Ppap2b-deficient and control mice. The studies showed that the autotaxin inhibitor PF8380 decreased plasma LPA levels in mice .

  • Receptor antagonist studies: Use specific LPA and S1P receptor antagonists to determine which receptor subtypes mediate the phenotypes observed in Ppap2b-deficient models. The pan-LPA receptor antagonist BrP-LPA reduced vascular permeability in both control and LPP3-deficient mice, implicating LPA signaling in this phenotype .

  • Biosynthesis inhibitor studies: Employ inhibitors of enzymes involved in LPA or S1P production (e.g., autotaxin inhibitor PF8380 for LPA) to determine if reducing the levels of these mediators affects the phenotype .

  • Genetic interaction studies: Cross Ppap2b-deficient mice with mice lacking specific LPA or S1P receptors to determine genetic interactions that could reveal which signaling pathway mediates particular phenotypes.

  • Downstream signaling analysis: Examine activation of signaling pathways downstream of LPA and S1P receptors (e.g., Rho, Rac, ERK) to determine which pathways are altered in Ppap2b-deficient models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.