Recombinant Mouse Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Lhfpl1; Lhfpl; LHFPL tetraspan subfamily member 1 protein; Lipoma HMGIC fusion partner-like 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-220
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lhfpl1
Target Protein Sequence
VASSTSYFLPYWLFGSQLGKPVSFSTFRRCNYPVRGDGHNLIMVEECGRYASFTAIPSLA WQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISAGCALYPL GWNSPEVMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVMLV ENIMRNTNSYALELDHCLKP
Uniprot No.

Target Background

Database Links

KEGG: mmu:237091

UniGene: Mm.135547

Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Strongly expressed in vagina and ovary. Weakly expressed in spleen, kidney, thymus, testis, brain, lung, intestine and uterus.

Q&A

What is Lipoma HMGIC Fusion Partner-like 1 (Lhfpl1) and its significance in research?

Lhfpl1 is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which belongs to the superfamily of tetraspan transmembrane protein encoding genes. The mouse Lhfpl1 gene is located on chromosome X, and the encoded protein contains a signal peptide sequence and three transmembrane regions. Its significance in research stems from the broader LHFP family's involvement in various biological processes, including potential roles in tissue development and disease progression .

Methodologically, when studying Lhfpl1, researchers should consider its evolutionary conservation, as it belongs to a distinct subfamily within tetraspan proteins. In mammals, TMHS (another family member), LHFPL3, and LHFPL4 comprise this subfamily, while insects and worms appear to have a single orthologous protein corresponding to the three-member mammalian subfamily .

What is the tissue distribution pattern of mouse Lhfpl1?

Lhfpl1 shows a broad tissue distribution pattern in mice. RT-PCR amplification studies have revealed that Lhfpl1 is expressed in various tissues with particularly high expression in:

TissueRelative Expression Level
LungHigh
ThymusHigh
Skeletal muscleHigh
ColonHigh
OvaryHigh
BrainModerate
Other tissuesDetectable

When designing tissue-specific experiments, researchers should consider that while gene expression database entries for Lhfpl1 are predominantly from brain tissue, the protein may be distributed more diffusely or exhibit differential translation efficiency across tissues .

How does Lhfpl1 relate to other members of the LHFPL family?

The LHFPL family comprises several members, including LHFPL1, LHFPL3, LHFPL4, and LHFPL6. These proteins share sequence similarities:

  • LHFPL3 and LHFPL4 share 62-66% amino acid identity with TMHS (another family member)

  • All family members share approximately 25% amino acid sequence similarity with the lipoma HMGIC fusion partner protein (LHFP)

  • The human ortholog of mouse Lhfpl1 is located on chromosome Xq23

When investigating functional relationships between family members, researchers should note that mutations in some LHFP-like genes result in specific phenotypes. For example, mutations in one LHFP-like gene cause deafness in humans and mice, while another LHFP-like gene is fused to a high-mobility group gene in translocation-associated lipoma .

What are the optimal conditions for prokaryotic expression of recombinant mouse Lhfpl1?

For efficient prokaryotic expression of recombinant mouse Lhfpl1, researchers should consider:

Expression system optimization:

  • Expression vector: Vectors with strong promoters such as T7 or tac are recommended

  • Host strain: BL21(DE3) or Rosetta strains have shown success for membrane proteins

  • Induction conditions: IPTG concentration of 0.5-1.0 mM at 16-18°C for 16-20 hours often yields better results for membrane proteins than standard conditions

Purification strategy:

  • Buffer composition: Tris-based buffer with 50% glycerol has been shown to optimize protein stability

  • Storage: Store at -20°C, with extended storage at -20°C or -80°C

  • Working conditions: Aliquot and store at 4°C for up to one week to avoid repeated freeze-thaw cycles

When validating expression, Western blotting with specific antibodies can be used to confirm the predicted molecular weight of 23.7 kDa, consistent with prokaryotic expression results reported in previous studies .

What experimental approaches are recommended for investigating Lhfpl1's function in neuronal development?

Based on evidence of Lhfpl1 expression in neural tissues, researchers investigating its role in neuronal development should consider:

Experimental design considerations:

  • Temporal expression analysis:

    • Examine expression at different developmental stages (E14.5, E15.5, E16.5, E17.5, P0, P9, P30) using RT-PCR and immunohistochemistry

    • Compare with established neuronal markers to identify developmental correlations

  • Loss-of-function studies:

    • CRISPR/Cas9-mediated gene knockout

    • RNAi-mediated knockdown followed by transcriptomic analysis

    • Phenotypic analysis of neural differentiation markers

  • Single-cell multiomics approaches:

    • Integrated analysis of scRNA-seq and ATAC-seq data to identify regulatory networks

    • Gene regulatory network prediction using computational methods as described in recent studies

The finding that Lhfpl1 is among the differentially expressed genes in mouse embryonic stem cells treated with tetrabromobisphenol A (TBBPA) suggests potential involvement in neuronal differentiation pathways that could be further investigated using these approaches .

How can researchers evaluate potential roles of Lhfpl1 in disease pathways?

To investigate Lhfpl1's potential roles in disease pathways, researchers should consider:

Cancer research approaches:

  • Expression analysis in tumor vs. normal tissues:

    • Examine Lhfpl1 expression in multiple cancer types using databases such as TCGA, ONCOMINE, and GEPIA

    • Consider that other LHFPL family members like LHFPL6 show associations with gastric cancer prognosis

  • Functional assays:

    • Cell migration and invasion assays (transwell experiments)

    • Co-culture systems to evaluate interactions with immune cells (e.g., macrophages)

    • Assessment of epithelial-mesenchymal transition (EMT) markers

Immune system involvement:

  • Evaluate expression correlations with immune infiltration using the CIBERSORT algorithm

  • Investigate potential associations with M2 macrophages, which are known immunosuppressors in tumor microenvironments

While most research has focused on LHFPL6 rather than LHFPL1 in cancer contexts, the methodological approaches for studying LHFPL6 can be adapted for Lhfpl1 research .

What are the recommended approaches for validating Lhfpl1 antibodies?

When validating antibodies against mouse Lhfpl1, researchers should implement the following comprehensive strategy:

Validation protocol:

  • Western blot validation:

    • Use recombinant Lhfpl1 protein as a positive control

    • Confirm specific detection at the expected molecular weight (23.7 kDa)

    • Test antibody specificity using knockout/knockdown samples

  • Blocking experiments:

    • Perform pre-incubation with a recombinant protein control fragment (such as aa 39-85)

    • Use a 100x molar excess of the protein fragment control based on antibody concentration and molecular weight

    • Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature

  • Cross-reactivity assessment:

    • Test against related family members (LHFPL3, LHFPL4, etc.)

    • Evaluate species cross-reactivity, noting high sequence conservation between mouse and rat (94%)

  • Application-specific validation:

    • For immunohistochemistry: Include appropriate positive and negative tissue controls

    • For ELISA: Generate standard curves using purified recombinant protein

What methods are recommended for studying protein-protein interactions involving Lhfpl1?

To investigate protein-protein interactions of mouse Lhfpl1, researchers should employ a multi-method approach:

In vitro methods:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-Lhfpl1 antibodies to pull down protein complexes

    • Identify interacting partners via mass spectrometry

    • Validate interactions by reverse Co-IP with antibodies against putative interacting proteins

  • Proximity labeling methods:

    • BioID or TurboID fusions to Lhfpl1 for proximal protein labeling

    • APEX2-based proximity labeling in live cells

    • These approaches are particularly valuable for transmembrane proteins like Lhfpl1

In silico methods:

  • Interactome prediction using databases such as STRING, BioGRID, and IntAct

  • Structural modeling to predict potential interaction domains

  • Cross-reference with interaction data from other LHFPL family members

Functional validation:

  • Co-localization studies using fluorescently tagged proteins

  • FRET or BRET assays to confirm direct interactions

  • Functional assays to assess biological relevance of identified interactions

How can researchers design experiments to study Lhfpl1's role in T cell function?

Based on recent findings about the involvement of tetraspan proteins in immune function, researchers investigating Lhfpl1's role in T cells should consider:

Experimental design framework:

  • Expression profiling:

    • Single-cell RNA sequencing of T cell subsets

    • Compare Lhfpl1 expression in naïve, activated, exhausted, and memory T cells

    • Correlate with established T cell function markers

  • Functional assays:

    • CRISPR-based gene editing to create Lhfpl1 knockout T cells

    • Assess T cell killing, proliferation, survival, and cytokine production (IL-2, IFN-γ, TNF)

    • Evaluate impact on CAR-T cell functionality using the T cell perturbation score (TPS) methodology

  • Mechanistic investigations:

    • Analyze effects on T cell receptor signaling pathways

    • Evaluate membrane organization and immunological synapse formation

    • Determine impact on immune checkpoint receptor expression and function

The TCPGdb database provides valuable reference data for designing T cell perturbation experiments, including expression analysis, co-expression networks, and associations with clinical outcomes in immunotherapy contexts .

What is known about the comparative biology of Lhfpl1 between mouse and human models?

When translating findings between mouse and human systems, researchers should consider:

Comparative analysis:

  • Sequence homology:

    • Mouse and human LHFPL1 share significant sequence similarity

    • Key structural features, including transmembrane domains, are conserved across species

  • Genomic location:

    • Mouse Lhfpl1 is located on chromosome X

    • Human LHFPL1 is mapped to Xq23

    • Syntenic regions may provide insights into evolutionary conservation

  • Expression patterns:

    • Both mouse and human LHFPL1 show broad tissue distribution

    • Neural tissue expression appears to be a conserved feature

    • Species-specific differences in relative expression levels across tissues may exist

For translational studies, researchers should validate findings across species using appropriate model systems and consider that while core functions may be conserved, regulatory mechanisms and tissue-specific roles might differ between mouse and human LHFPL1.

What methodologies are most effective for studying the role of Lhfpl1 in mouse development?

To investigate Lhfpl1's developmental functions, researchers should employ:

Developmental biology approaches:

  • Temporal expression profiling:

    • Analyze expression at key developmental stages (E14.5 through P60)

    • Use both RNA analysis (RT-PCR, RNA-seq) and protein detection (immunohistochemistry)

    • Compare with developmental marker genes

  • Genetic manipulation strategies:

    • Generate conditional knockout models using Cre-loxP systems for tissue-specific deletion

    • Apply CRISPR/Cas9 for precise genome editing

    • Consider knockin reporter systems (e.g., GFP fusion) to track expression in vivo

  • Single-cell approaches:

    • Implement single-cell RNA sequencing during development

    • Use trajectory analysis to identify developmental processes involving Lhfpl1

    • Integrate with epigenetic profiling to understand regulatory mechanisms

The finding that Lhfpl1 is differentially expressed in response to environmental toxicants like TBBPA suggests potential roles in developmental toxicology that merit further investigation .

How should researchers approach the analysis of contradictory data regarding Lhfpl1 function?

When faced with conflicting evidence about Lhfpl1 function, researchers should:

Data reconciliation strategy:

  • Critical evaluation of methodological differences:

    • Compare antibody specificity and validation methods across studies

    • Assess differences in experimental models (cell lines, primary cells, in vivo models)

    • Evaluate the sensitivity and specificity of detection methods used

  • Context-dependent function assessment:

    • Consider tissue-specific regulatory mechanisms

    • Evaluate developmental stage-specific effects

    • Assess compensation by other family members in knockout models

  • Integrated multi-omics approach:

    • Combine transcriptomic, proteomic, and functional data

    • Use pathway analysis to identify convergent mechanisms

    • Apply systems biology approaches to model complex interactions

For example, the apparent contradiction between Lhfpl1 mRNA expression in brain versus protein localization could be addressed by examining translational efficiency, protein stability, or diffuse versus concentrated protein distribution patterns .

What are the recommended storage and handling protocols for recombinant mouse Lhfpl1 protein?

For optimal stability and activity of recombinant mouse Lhfpl1 protein, researchers should follow these guidelines:

Storage and handling recommendations:

  • Long-term storage:

    • Store at -20°C, with extended storage at -20°C or -80°C

    • Use Tris-based buffer with 50% glycerol to maintain protein stability

    • Avoid repeated freeze-thaw cycles

  • Working solutions:

    • Store working aliquots at 4°C for up to one week

    • Optimize buffer conditions based on specific experimental applications

    • Consider the addition of protease inhibitors for sensitive applications

  • Quality control measures:

    • Perform regular activity/integrity checks

    • Use SDS-PAGE to confirm protein integrity before critical experiments

    • Validate functional activity in appropriate assay systems

These recommendations are based on established protocols for recombinant Lhfpl1 and related proteins, though specific requirements may vary depending on experimental context and protein preparation methods .

How can researchers optimize experimental design for studying Lhfpl1 in specific disease models?

When investigating Lhfpl1 in disease contexts, researchers should implement the following experimental design principles:

Disease model optimization:

  • Model selection considerations:

    • Choose models that express Lhfpl1 at levels relevant to the disease context

    • Consider tissue-specific conditional models for diseases affecting organs with high Lhfpl1 expression

    • Evaluate both genetic and pharmacological perturbation approaches

  • Experimental controls:

    • Include wild-type, heterozygous, and homozygous mutant animals when possible

    • Implement age and sex-matched controls

    • Use multiple independent lines or clones to rule out off-target effects

  • Translational relevance assessment:

    • Compare findings with human patient data when available

    • Validate in multiple model systems (cell lines, primary cells, animal models)

    • Apply disease-relevant functional assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.