Recombinant Mouse Lipoma HMGIC fusion partner-like 4 protein (Lhfpl4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Lhfpl4

Lhfpl4 belongs to the tetraspanin family of transmembrane proteins, characterized by four transmembrane domains . Recombinant versions are produced via heterologous expression systems, often with affinity tags (e.g., His-tag, GST) for purification .

Key Features

FeatureDetailsSource
Gene ID269788 (Mouse)
Uniprot IDQ5U4E0
Molecular Weight~28.2 kDa (with tags)
Expression SystemsE. coli, HEK-293 cells, wheat germ, insect cells

Expression and Production

Recombinant Lhfpl4 is synthesized in various systems to optimize solubility and yield.

Expression Systems and Tags

SystemTagPurityApplications
E. coliN-terminal His-tag>95%Crystallization, SDS-PAGE
HEK-293 cellsrho-1D4 tag>90%Western blotting, ELISA
Wheat germGST (N-terminal)>80%ELISA, affinity purification

Notes:

  • E. coli is the most common system for high yields .

  • Insect cell systems are used for post-translational modifications .

  • Wheat germ systems preserve native folding for functional studies .

Domain Organization

DomainFunction
Transmembrane 1-4Anchoring in lipid bilayers, facilitating protein clustering
Intracellular LoopsInteractions with GABA receptor subunits (e.g., α2, β2)
C-terminalBinding sites for synaptic scaffolding proteins (e.g., gephyrin)

Functional Role in Neurobiology

Lhfpl4 is essential for inhibitory synapse assembly, particularly in hippocampal pyramidal neurons.

Key Research Findings

MechanismObservationSource
GABA Receptor ClusteringDirect interaction with GABA receptor subunits; knockout mice show ~90% reduction in synaptic GABA receptors .
Synaptic LocalizationColocalizes with gephyrin and VGAT at inhibitory synapses .
Cell-Type SpecificityAffects pyramidal neurons but not interneurons .
Gephyrin Aggregate FormationKnockout causes cytoplasmic gephyrin aggregates, disrupting synaptic structure .

Research Challenges and Future Directions

  • Tag Optimization: Balancing solubility and native folding remains critical .

  • Synaptic Mechanisms: Elucidating Lhfpl4’s interaction with gephyrin and GABA receptors requires advanced imaging techniques (e.g., cryo-EM) .

  • Therapeutic Potential: Targeting Lhfpl4 in neurological disorders (e.g., epilepsy, autism) warrants further exploration .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Lhfpl4; Garlh4; Kiaa4027; Lh4; LHFPL tetraspan subfamily member 4 protein; GABAA receptor regulatory Lhfpl4; Lipoma HMGIC fusion partner-like 4 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lhfpl4
Target Protein Sequence
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFG LFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFALFFFCN TATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILA IIGILNALILSFLAFVLGNRQTDLLQEELKQENKDFVGTTVSSVLRPGGDVSGWGVLPCP VAHTQGP
Uniprot No.

Target Background

Function
LHFPL4 plays a crucial role in the regulation of inhibitory synapse formation and function. It contributes to maintaining the clustering of gamma-aminobutyric acid receptors (GABAARs) and their associated scaffold proteins at inhibitory synaptic sites. LHFPL4 acts in conjunction with NLGN2 to recruit or stabilize GABAARs.
Gene References Into Functions
  1. Research findings establish LHFPL4 as a synapse-specific tetraspanin essential for inhibitory synapse function. These results provide valuable insights into the molecular composition of inhibitory synapses. PMID: 28978485
Database Links
Protein Families
LHFP family
Subcellular Location
Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the brain, including the cortex, hippocampus, midbrain, olfactory bulb pona plus medulla (at protein level). Expressed in the in the cerebellar granular layer and in granular layer. Colocalized with GPHN at inhibitory synapses. Weakly

Q&A

What is the genomic organization and expression pattern of Lhfpl4?

Lhfpl4 is a protein-coding gene located on chromosome 3p25.3 in humans and is a member of the lipoma HMGIC fusion partner (LHFP) gene family. It consists of 5 exons spanning approximately 55 kb of genomic DNA (9498361-9553822, complement strand) . The gene encodes a 247-amino acid protein that belongs to the superfamily of tetraspan transmembrane proteins .

The protein is also known by the alternative name GARLH4 (GABAᴀ Receptor Regulatory LHFPL protein 4) . Expression studies reveal that Lhfpl4 is predominantly expressed in neuronal tissues, with specific enrichment at inhibitory postsynaptic sites where it colocalizes with GABAᴀ receptors and the scaffolding protein gephyrin . The expression patterns correlate with regions of inhibitory synaptic transmission in the brain, particularly in hippocampal and cerebellar neurons.

What are the known binding partners and protein interactions of Lhfpl4?

Lhfpl4 forms protein complexes with key components of inhibitory synapses. Co-immunoprecipitation experiments with LHFPL4 antibodies have demonstrated that Lhfpl4 natively interacts with:

  • GABAᴀ receptor α1 subunit

  • Gephyrin (the main scaffolding protein at inhibitory synapses)

  • Neuroligin-2 (NL2), an inhibitory postsynaptic adhesion molecule

These interactions have been confirmed through reciprocal co-immunoprecipitation experiments, where LHFPL4 could be co-immunoprecipitated with a neuroligin-2 antibody from brain lysates . The protein-protein interaction network suggests that Lhfpl4 serves as a critical organizing element in the macromolecular complex of inhibitory postsynaptic domains.

Studies have identified Neuroligin-2 as a major binding partner for LHFPL4/GARLH4, with both proteins regulating the expression levels and synaptic clustering of each other, particularly in the cerebellum .

What phenotypes are observed in Lhfpl4 knockout models?

Lhfpl4 knockout (Lhfpl4-/-) mice display several pronounced phenotypes that highlight the critical importance of this protein in neuronal function:

Phenotypic FeatureObservation in Lhfpl4-/- MiceTechnique UsedReference
GABAᴀR clustering60% reduction in mIPSC frequencyElectrophysiology
Gephyrin clusteringDramatic lossImmunofluorescence
GABAᴀR-γ2 clusteringMarked decreaseImmunofluorescence
VGAT-positive/gephyrin co-clustersSignificant reductionConfocal microscopy
Excitatory synapses (Homer)UnchangedImmunofluorescence
Inhibitory presynaptic terminalsUnaffectedVGAT labeling
Motor behaviorSevere deficitsBehavioral testing
SurvivalPremature deathLongevity assessment
Gephyrin localizationFormation of large somatic and dendritic aggregatesImmunohistochemistry

These findings demonstrate that Lhfpl4 is essential for proper inhibitory synapse formation and function, while not affecting excitatory synapse development or presynaptic inhibitory terminals .

What are the optimal methods for detecting and quantifying Lhfpl4 expression?

When designing experiments to detect and quantify Lhfpl4 expression, researchers should consider multiple complementary approaches:

Protein Detection:

  • Western Blotting: Use specific anti-LHFPL4 antibodies with appropriate controls, including Lhfpl4-/- tissue as a negative control. The 247-amino acid protein has a predicted molecular weight of approximately 27-30 kDa .

  • Immunohistochemistry/Immunofluorescence: For visualization of LHFPL4 in tissue sections or cultured neurons, use antibodies that recognize surface epitopes. Co-labeling with markers for inhibitory synapses (gephyrin, VGAT, GABAᴀR subunits) provides spatial context .

mRNA Detection:

  • RT-qPCR: Design primers spanning exon-exon junctions to avoid genomic DNA amplification.

  • In situ hybridization: For spatial localization of mRNA expression in brain sections.

Quantification Methods:

  • For immunofluorescence imaging, use laser scanning confocal microscopy (LSCM) to quantify cluster density, size, and colocalization with synaptic markers .

  • Analysis parameters should include:

    • Cluster density (number per unit area of dendrite)

    • Cluster size (area in μm²)

    • Colocalization coefficient with synaptic markers

    • Fluorescence intensity as a measure of protein abundance

Standardization using housekeeping proteins or genes is essential for accurate quantification across different experimental conditions.

How can researchers effectively design experiments to study Lhfpl4 function at inhibitory synapses?

To study Lhfpl4 function at inhibitory synapses, consider these experimental approaches:

Genetic Manipulation:

  • Knockout Models: Generate constitutive or conditional Lhfpl4 knockout mice using CRISPR/Cas9 or traditional gene targeting approaches. Conditional knockouts using Cre-loxP systems allow for temporal and spatial control of gene deletion .

  • RNAi Knockdown: Use shRNA or siRNA for acute reduction of Lhfpl4 expression in cultured neurons or through in vivo delivery.

  • Overexpression Studies: Express wild-type or mutant Lhfpl4 constructs to assess gain-of-function or dominant-negative effects.

Functional Assays:

  • Electrophysiology: Record miniature inhibitory postsynaptic currents (mIPSCs) to assess synaptic function. In Lhfpl4-/- neurons, mIPSC frequency is reduced by approximately 60%, indicating loss of functional inhibitory synapses .

  • Synaptogenesis Assays: The mixed-culture assay can be used to assess synaptogenic properties of Lhfpl4. This involves co-culturing COS-7 cells overexpressing Lhfpl4 with dissociated hippocampal neurons, followed by immunostaining for presynaptic markers to detect hemi-synapse formation .

Protein Interaction Studies:

  • Co-immunoprecipitation: To identify protein complexes containing Lhfpl4.

  • Proximity Ligation Assay (PLA): For in situ detection of protein-protein interactions.

  • FRET/BRET Assays: To study dynamic interactions between Lhfpl4 and binding partners.

Imaging Approaches:

  • Super-resolution Microscopy: Techniques such as STORM or PALM can resolve the nanoscale organization of Lhfpl4 at synapses.

  • Live-Cell Imaging: Using fluorescently tagged Lhfpl4 to monitor its trafficking and dynamics at synapses in real-time.

What are the critical considerations when expressing and purifying recombinant Lhfpl4 protein?

Expressing and purifying recombinant Lhfpl4 presents several challenges due to its nature as a tetraspan transmembrane protein. Researchers should consider:

Expression Systems:

  • Mammalian Cells: HEK293 or CHO cells often yield properly folded transmembrane proteins with appropriate post-translational modifications.

  • Insect Cells: Baculovirus expression systems can produce higher yields of membrane proteins while maintaining proper folding.

  • Cell-Free Systems: May be useful for initial screening of constructs but typically yield lower amounts of functional protein.

Construct Design:

  • Tags: Include purification tags (His, FLAG, etc.) positioned to avoid interference with function. Consider including a fluorescent protein tag (GFP, mCherry) for visualization.

  • Solubility Enhancement: Consider fusion partners (MBP, SUMO) to improve solubility.

  • Deletion Constructs: Generate constructs lacking transmembrane domains for studies of soluble domains.

Extraction and Purification:

  • Detergent Selection: Critical for membrane protein solubilization. Test a panel of detergents (DDM, CHAPS, digitonin) to identify optimal conditions for maintaining protein structure and function.

  • Buffer Optimization: Include stabilizing agents (glycerol, specific lipids) to maintain protein stability during purification.

  • Purification Strategy: Typically involves affinity chromatography followed by size exclusion chromatography to separate monomeric from aggregated protein.

Quality Control:

  • Structural Integrity: Circular dichroism or thermal shift assays to assess proper folding.

  • Functional Assays: Binding assays with known partners (e.g., Neuroligin-2, GABAᴀR subunits).

  • Homogeneity Assessment: SEC-MALS, DLS, or analytical ultracentrifugation to confirm monodispersity.

How does Lhfpl4 contribute to inhibitory synapse organization at the molecular level?

Lhfpl4 serves as a critical organizer of inhibitory postsynaptic domains through several molecular mechanisms:

1. Scaffolding Function:

  • Lhfpl4 acts as a molecular bridge between GABAᴀ receptors and the postsynaptic scaffolding protein gephyrin .

  • In Lhfpl4-/- neurons, gephyrin fails to properly cluster at inhibitory synapses and instead forms large aggregates in soma and dendrites, suggesting Lhfpl4 is necessary for proper gephyrin targeting .

2. Receptor Clustering:

  • Lhfpl4 is required for proper clustering of GABAᴀ receptors at inhibitory synapses. Studies show a dramatic decrease in GABAᴀR-γ2 and GABAᴀR-α2 clustering in Lhfpl4-/- neurons and brain tissues .

  • The mechanism appears to involve direct protein-protein interactions rather than transcriptional regulation of receptor subunits.

3. Trans-Synaptic Signaling:

  • Lhfpl4 interacts with Neuroligin-2, an adhesion molecule that spans the synaptic cleft and interacts with presynaptic components .

  • This interaction suggests Lhfpl4 may participate in trans-synaptic signaling complexes that coordinate pre- and postsynaptic differentiation.

4. Synapse Specificity:

  • Lhfpl4 specifically affects inhibitory synapses while leaving excitatory synapses (marked by Homer) intact .

  • This specificity suggests Lhfpl4 participates in mechanisms that differentiate inhibitory from excitatory postsynaptic domains.

The molecular architecture of this complex can be visualized as a network where Lhfpl4 serves as a central hub connecting multiple components of the inhibitory postsynapse, including:

  • Membrane components: GABAᴀ receptors, Neuroligin-2

  • Scaffolding proteins: Gephyrin

  • Potentially other unidentified partners

What techniques are most effective for studying Lhfpl4 localization and dynamics in live neurons?

Studying the localization and dynamics of Lhfpl4 in live neurons requires sophisticated imaging approaches:

1. Fluorescent Protein Tagging Strategies:

  • Selection of Fluorophore: Use monomeric, photostable fluorescent proteins (mEGFP, mCherry) to minimize artifacts.

  • Tag Position: Consider both N- and C-terminal tags, testing for functional equivalence to untagged protein.

  • Knock-in Approaches: CRISPR/Cas9 can be used to tag endogenous Lhfpl4 to avoid overexpression artifacts.

2. Advanced Imaging Techniques:

  • FRAP (Fluorescence Recovery After Photobleaching): To measure Lhfpl4 mobility within membranes and exchange rates at synapses.

  • Single Particle Tracking: To follow individual Lhfpl4 molecules in neuronal membranes, revealing diffusion characteristics and confinement at synapses.

  • FLIM-FRET: To detect interactions with binding partners in living neurons with nanometer resolution.

  • Optogenetic Approaches: Light-inducible dimerization systems can be used to manipulate Lhfpl4 clustering or interactions in real-time.

3. Multi-Color Imaging:

  • Combine Lhfpl4 labeling with markers for inhibitory synapses (gephyrin-FP) and GABAᴀ receptors (α1-FP, γ2-FP) to correlate dynamics.

  • Use spectral unmixing for optimal separation of multiple fluorophores.

4. Long-Term Imaging:

  • Employ longitudinal imaging in organotypic slice cultures to track synapse formation and stability over days to weeks.

  • Use incubation chambers with precise environmental control to maintain neuronal health during extended imaging sessions.

5. Data Analysis Approaches:

  • Implement automated tracking algorithms to quantify protein movement.

  • Use correlation analyses to identify coordinated movements of different synaptic components.

  • Apply machine learning approaches to classify dynamic behaviors of Lhfpl4-containing complexes.

How can researchers address contradictory findings regarding Lhfpl4 function?

When faced with contradictory findings in Lhfpl4 research, investigators should implement a systematic approach to resolve discrepancies:

1. Methodological Standardization:

  • Antibody Validation: Use multiple antibodies targeting different epitopes of Lhfpl4 and validate specificity using Lhfpl4-/- tissue as negative control.

  • Genetic Models: Compare different knockout/knockdown strategies (constitutive vs. conditional, germline vs. acute) to identify potential compensatory mechanisms.

  • Expression Systems: Standardize expression levels in overexpression studies to avoid artifacts from non-physiological protein concentrations.

2. Contextual Factors to Consider:

  • Developmental Stage: Lhfpl4 function may vary across development, requiring age-matched comparisons.

  • Cell-Type Specificity: Examine Lhfpl4 function in defined neuronal populations, as effects may differ between cell types.

  • Brain Region Variability: Compare findings across different brain regions, as molecular composition of inhibitory synapses varies regionally.

3. Collaborative Approaches:

  • Establish multi-laboratory validation studies using standardized protocols.

  • Share reagents, animals, and raw data to enable direct comparisons.

  • Consider blind analysis of data to minimize confirmation bias.

4. Statistical and Reporting Considerations:

  • Use appropriate statistical methods with adequate sample sizes and power analyses.

  • Report negative results alongside positive findings to provide a complete picture.

  • Follow guidelines for resolving contradictions in data analysis results by re-examining data, methods, and assumptions with curiosity and skepticism .

5. Integration of Multiple Techniques:

What are the implications of Lhfpl4 dysfunction for neurological disorders?

Given the critical role of Lhfpl4 in inhibitory synapse formation and function, its dysfunction may contribute to neurological disorders characterized by excitatory/inhibitory imbalance:

1. Potential Disorder Associations:

  • Epilepsy: Lhfpl4-/- mice show reduced inhibitory synaptic transmission, which could lead to hyperexcitability and seizures .

  • Neurodevelopmental Disorders: Impaired inhibitory synapse formation during critical periods of development could contribute to conditions like autism spectrum disorders.

  • Motor Coordination Disorders: The prominent motor behavioral deficits observed in Lhfpl4-/- mice suggest potential involvement in movement disorders .

2. Evidence from Animal Models:

  • Lhfpl4-/- mice display premature death and significant motor impairments .

  • The disruption of GABAergic transmission in these mice parallels findings in various neurological conditions.

3. Screening Approaches for Human Variants:

  • Targeted Sequencing: Screen for LHFPL4 variants in patient cohorts with relevant phenotypes.

  • Functional Validation: Test identified variants using cellular assays of GABAᴀR clustering and inhibitory synapse formation.

  • Animal Modeling: Generate knock-in models of human variants to assess phenotypic consequences.

4. Therapeutic Implications:

  • Modulating Lhfpl4 function or expression could potentially restore inhibitory synapse formation in disorders characterized by reduced inhibition.

  • Compounds that enhance the interaction between Lhfpl4 and its binding partners might strengthen existing inhibitory synapses.

What are emerging directions for Lhfpl4 research in neuroscience?

The field of Lhfpl4 research is evolving rapidly, with several promising directions for future investigation:

1. Structural Biology:

  • Determine the three-dimensional structure of Lhfpl4 alone and in complex with binding partners to understand interaction interfaces.

  • Use cryo-electron microscopy to visualize the architecture of Lhfpl4-containing macromolecular complexes at inhibitory synapses.

2. Circuit-Level Functions:

  • Explore how Lhfpl4-dependent inhibitory synapses contribute to neural circuit function and behavior.

  • Use cell-type-specific manipulation of Lhfpl4 to dissect its role in distinct inhibitory circuits.

3. Developmental Regulation:

  • Investigate the temporal expression and function of Lhfpl4 during brain development.

  • Determine how Lhfpl4 contributes to critical period plasticity of inhibitory circuits.

4. Interactome Mapping:

  • Perform comprehensive proteomics to identify the complete set of Lhfpl4-interacting proteins across brain regions and developmental stages.

  • Use proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity of Lhfpl4 at inhibitory synapses.

5. Therapeutic Applications:

  • Develop small molecules or peptides that target Lhfpl4 interactions to modulate inhibitory synapse formation or function.

  • Explore gene therapy approaches to correct Lhfpl4 dysfunction in relevant neurological disorders.

What are the key takeaways for researchers studying Lhfpl4?

Lhfpl4/GARLH4 represents a critical molecular component of inhibitory synapses with essential functions in brain development and function. Research has established that this tetraspan transmembrane protein:

  • Is specifically enriched at inhibitory postsynaptic sites where it forms complexes with GABAᴀ receptors, gephyrin, and neuroligin-2 .

  • Is essential for proper clustering of inhibitory postsynaptic components, with Lhfpl4 knockout resulting in dramatic reductions in GABAᴀR and gephyrin clustering .

  • Has functional significance, as its loss leads to reduced inhibitory synaptic transmission, motor deficits, and premature death in mouse models .

  • Shows specificity for inhibitory synapses, not affecting excitatory synapse formation or presynaptic inhibitory terminals .

Researchers entering this field should consider both the molecular and systemic aspects of Lhfpl4 function, employing multidisciplinary approaches to address the complex questions surrounding its role in neural development and function. The integration of structural, functional, and behavioral studies will be essential for a comprehensive understanding of how this protein contributes to brain health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.