Recombinant Mouse Lipoma HMGIC fusion partner (Lhfp)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse Lipoma HMGIC Fusion Partner (Lhfp) is a protein associated with lipomas, a common type of benign tumor composed of fat cells . Lhfp is of interest due to its involvement in chromosomal translocations, particularly those involving the High-Mobility Group I-C (HMGIC) gene, also known as HMGA2, at chromosome 12q15 . These translocations are frequently observed in lipomas and other benign tumors .

Gene Identification and Mapping

The human gene, Lipoma HMGIC Fusion Partner (LHFP), was identified as a novel translocation partner of HMGIC in a lipoma exhibiting a t(12;13) translocation . This gene, LHFP, maps to the long arm of chromosome 13, a region often implicated in chromosomal aberrations in lipomas .

Protein Structure and Homology

The LHFP gene encodes a protein of 200 amino acids . The predicted human LHFP protein shares significant similarity with a translated mouse EST (Expressed Sequence Tag) that covers almost the entire coding region of LHFP . Further bioinformatic analysis reveals that the LHFP protein belongs to a new protein family with at least four or five members .

Expression and Function

Northern blot analysis has detected a transcript of approximately 2.4 kb for LHFP in various human tissues, suggesting a widespread expression pattern . In lipomas with t(12;13) translocations, the expressed HMGIC/LHFP fusion transcript encodes the three DNA-binding domains of HMGIC, followed by 69 amino acids derived from a frame-shifted LHFP sequence . Lhfp is highly expressed in bone and osteoblasts .

Role in Tumorgenesis

LHFP is the second translocation partner of HMGIC identified in lipomas and represents a candidate target gene for lipomas associated with 13q aberrations . The translocation and fusion with HMGIC suggest that LHFP dysregulation may play a role in the development of lipomas.

Association with HMGI-C/HMGI(Y)

Immunohistochemical studies have demonstrated a correlation between HMGI-C and HMGI(Y) expression and cytogenetic or FISH (Fluorescence In Situ Hybridization) analysis in various tumors . HMGI-C and HMGI(Y) immunoreactivity was observed in a significant percentage of tumors with chromosomal alterations at 12q15 or 6p21 .

Significance

LHFPL4 is identified as a synapse-specific tetraspanin that is essential for inhibitory synapse function .

Table: HMGI-C/HMGI(Y) Immunoreactivity and Cytogenetic/FISH Analysis in Tumors

ParameterHMGI-C PositiveHMGI(Y) Positive
Tumors with 12q15 or 6p21 chromosomal alterations85.7%95.0%
Association with karyotypic alterations at 12q15 and/or HMGI-C rearrangement detected by FISHp = 0.005N/A
Association of karyotypic alterations at 6p21 and/or HMGI(Y) FISH resultsN/Ap = 0.001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Lhfpl6; Lhfp; LHFPL tetraspan subfamily member 6 protein; Lipoma HMGIC fusion partner
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-200
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Lhfpl6
Target Protein Sequence
CVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWR ICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGW DSEEVRQTCGYISGQFDLGKCEIGWAYYCTGAGAAAAMLLCTWMACFSGKKQKHYPY
Uniprot No.

Target Background

Database Links

KEGG: mmu:108927

UniGene: Mm.118617

Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methodological approaches are recommended for studying Lhfp's role in osteoblast differentiation?

Based on published research methodologies, several complementary approaches are recommended for investigating Lhfp's role in osteoblast differentiation:

a) Colony-forming unit-fibroblast (CFU-F) assays: This direct measurement of bone marrow stromal cells (BMSCs) has revealed increased BMSC numbers in Lhfp knockout mice, indicating Lhfp's role in regulating the osteoprogenitor pool .

b) In vitro mineralization assays: BMSCs from Lhfp-deficient mice demonstrate increased mineralization when measured by bound alizarin red, confirming enhanced osteogenic differentiation potential .

c) Bone mineral density (BMD) measurements: Dual-energy X-ray absorptiometry provides quantitative assessment of bone density differences between Lhfp knockout and wild-type mice.

d) Micro-computed tomography (microCT): This technique allows detailed analysis of both cortical and trabecular bone compartments, revealing that Lhfp deficiency specifically affects cortical bone parameters .

e) Gene co-expression network analysis: This systems biology approach identifies genes co-expressed with Lhfp in bone tissue, providing insights into the molecular networks through which Lhfp functions .

For comprehensive characterization, these approaches should be integrated to connect cellular, molecular, and whole-organism phenotypes.

  • How does Lhfp deficiency affect bone mineral density and microarchitecture in mice?

Lhfp deficiency produces specific and significant effects on bone parameters:

a) Bone Mineral Density (BMD):

  • Female Lhfp knockout mice on a high-fat diet exhibit significantly increased femoral BMD at 32 weeks of age (P = 2.6 x 10^-3)

  • This effect demonstrates sexual dimorphism, as male mice don't show comparable BMD differences under the same conditions

  • The phenotype aligns with the negative correlation observed between Lhfp expression and BMD in genetic studies

b) Cortical Bone Parameters:

  • Both male and female Lhfp knockout mice display significantly increased femoral cortical bone area fraction (BA/TA) and cortical thickness (Ct.Th)

  • Male Lhfp knockout mice also show significantly increased tissue mineral density (TMD) (P = 0.03)

  • These effects persist at 52 weeks of age, although with slightly diminished statistical significance

c) Trabecular Bone:

  • Notably, no significant effects were observed on trabecular bone mass at the distal femur in either sex

  • This compartment-specific effect suggests Lhfp regulates distinct aspects of bone development

These findings establish Lhfp as a negative regulator of cortical bone mass, with its absence leading to increased bone formation, particularly affecting the cortical compartment .

  • What molecular mechanisms underlie Lhfp's regulation of osteoblast activity?

The molecular mechanisms through which Lhfp regulates osteoblast activity remain partially understood, but research has revealed several important aspects:

a) Co-expression network associations: Lhfp belongs to module 9 in a bone co-expression network enriched for genes involved in osteoblast differentiation and BMD regulation, suggesting it functions within a coordinated gene program controlling bone formation .

b) Regulation of osteoprogenitor pool: Lhfp negatively regulates the number of bone marrow stromal cells (BMSCs), as evidenced by increased colony-forming unit-fibroblast (CFU-F) numbers in Lhfp-deficient mice .

c) Suppression of osteoblast differentiation: BMSCs from Lhfp knockout mice show enhanced mineralization in vitro, indicating Lhfp normally limits osteoblast differentiation and/or function .

d) Genetic regulation: Lhfp expression is regulated by a local expression quantitative trait locus (eQTL) in liver, with B6 alleles associated with increased Lhfp expression and decreased BMD. This inverse relationship supports Lhfp's role as a negative regulator of bone mass .

As a tetraspan transmembrane protein, Lhfp likely participates in membrane organization, cell-cell interactions, or signaling pathway regulation, though the precise interactions remain to be characterized through further molecular studies.

  • How can CRISPR/Cas9 be optimally utilized to generate Lhfp knockout mice?

Based on published methodologies, the following protocol has proven effective for generating Lhfp knockout mice using CRISPR/Cas9:

a) sgRNA design: Select a 20-nucleotide target sequence in Exon 2, approximately 300bp downstream of the start codon, using established CRISPR design tools. This strategic targeting is crucial since the ATG start codon is located in Exon 2 of Lhfp .

b) sgRNA construction: Synthesize oligonucleotides of the chosen sequence and its reverse complement with additional nucleotides (CTTC and AAAC) at the 5' ends for cloning purposes. Anneal these oligonucleotides by heating to 90°C for 5 minutes followed by cooling to room temperature .

c) Vector preparation: Clone the annealed oligonucleotides into a BbsI-digested pX330 plasmid vector using T4 DNA ligase, then transform competent bacteria. Sequence selected clones to verify accurate insertion .

d) RNA preparation: Generate sgRNA through in vitro transcription (IVT) using the MAXIscript T7 kit and synthesize Cas9 mRNA following established protocols .

e) Microinjection: Co-inject fertilized eggs from super-ovulated C57BL/6N females with purified Cas9 mRNA (100 ng/μl) and sgRNA (30 ng/μl) .

f) Embryo handling: Culture injected eggs overnight in KSOM-AA medium and implant two-cell stage embryos into pseudo-pregnant female mice .

g) Genotyping: Screen resulting pups by PCR of tail DNA followed by sequencing to identify mutations .

This approach has successfully produced multiple Lhfp mutant lines with different deletion sizes, all causing frameshift mutations that effectively disrupt gene function.

  • How can systems genetics approaches be applied to study Lhfp in bone development?

Systems genetics provides powerful frameworks for studying Lhfp's role in bone development:

a) Integrated GWAS and expression analysis: This approach identified a significant BMD locus on Chromosome 3@52.5 Mbp through GWAS and then leveraged expression data to implicate Lhfp as the causal gene .

b) eQTL mapping across tissues: Expression quantitative trait loci (eQTL) analysis in multiple tissues identified a highly significant local eQTL for Lhfp in liver (LOD = 19.9), revealing genetic variants that regulate Lhfp expression and correlate with bone phenotypes .

c) Co-expression network construction: By analyzing coordinated gene expression patterns in bone tissue from the Hybrid Mouse Diversity Panel (HMDP), researchers identified Lhfp within a module enriched for osteoblast-related genes, predicting its function before experimental validation .

d) Cross-species validation: After identifying Lhfp's role in mice, researchers found SNPs in human LHFP associated with heel BMD (P = 1.2 x 10^-5), supporting translational relevance .

e) Multi-strain phenotyping: Validating the Lhfp-containing BMD locus across multiple strain panels and an F2 intercross strengthened the evidence for its biological importance .

f) Correlation of genetic, expression, and phenotypic data: The negative correlation between Lhfp expression and BMD helped predict the direction of Lhfp's effect on bone before experimental confirmation .

This integrated approach connects genetic variation, gene expression, and phenotypic outcomes across biological scales, generating testable hypotheses about gene function.

  • What technical considerations are important when analyzing Lhfp in bone co-expression networks?

When analyzing Lhfp in co-expression networks for bone research, several technical considerations are crucial:

a) Tissue specificity: Using the appropriate tissue-specific expression data is essential, as Lhfp's co-expression patterns may differ across tissues. The bone network revealed Lhfp's association with osteoblast-related genes that might not be apparent in other tissues .

b) Network construction methods: Different algorithms (WGCNA, Bayesian networks, etc.) may yield different results. The published research used Topological Overlap Measures (TOMs) to identify genes with strong connections to Lhfp .

c) Module detection parameters: The approach used for module detection (hierarchical clustering, k-means) and parameters chosen (merge height, minimum module size) significantly impact which genes cluster with Lhfp .

d) Functional enrichment analysis: Gene Ontology (GO) analysis using the PANTHER database statistical overrepresentation test characterizes the biological significance of Lhfp-containing modules. The choice of background gene set and statistical methods affects interpretation .

e) Integration with genetic data: Properly mapping genetic variants to genes and incorporating the direction of genetic effects enhances the biological relevance of co-expression findings .

f) Validation strategy: Network-based predictions require experimental validation. In the case of Lhfp, its predicted role in osteoblast function was confirmed through knockout models .

g) Sample size considerations: The reliability of co-expression networks depends on sufficient sample sizes. The Hybrid Mouse Diversity Panel (HMDP) provided adequate statistical power for detecting meaningful co-expression relationships .

These methodological considerations are essential for generating robust, biologically meaningful insights from co-expression network analysis.

  • What challenges exist in translating mouse Lhfp findings to human LHFP function?

Translating findings from mouse Lhfp studies to human LHFP function faces several challenges:

a) Sequence conservation vs. functional conservation: While there is high conservation between mouse and human LHFP proteins , functional conservation requires experimental validation. Subtle differences may affect protein interactions or regulatory mechanisms.

b) Complex phenotypic interactions: Bone phenotypes are influenced by numerous factors including diet, exercise, age, and hormonal status. Mouse studies showed that Lhfp effects on BMD were detected in female mice on a high-fat diet but not in males, highlighting these complexities .

c) Genetic background effects: Mouse studies typically use inbred strains with homogeneous genetic backgrounds, whereas human populations have diverse genetic backgrounds that may modify LHFP effects .

d) Tissue-specific regulation: Research identified a local eQTL for Lhfp in mouse liver but not in bone, indicating complex tissue-specific regulation that may differ between species .

e) Human sample limitations: Access to human bone samples for expression and functional studies is restricted compared to mouse models, making direct validation challenging.

f) Regulatory landscape differences: The genomic context and regulatory elements controlling LHFP expression may differ between species.

Despite these challenges, researchers have identified SNPs in human LHFP associated with heel BMD (P = 1.2 x 10^-5), suggesting functional conservation between species and supporting the translational relevance of mouse Lhfp studies .

  • How does Lhfp relate to other members of the LHFP gene family?

Lhfp belongs to the lipoma HMGIC fusion partner (LHFP) gene family, which has several distinctive characteristics:

a) Family composition: The LHFP family consists of multiple members including LHFP (also called LHFPL6), LHFPL1, LHFPL2, LHFPL3, and others .

b) Structural similarities: All family members share the tetraspan transmembrane protein structure, suggesting similar membrane localization and potential functional similarities .

c) Diverse biological roles: While Lhfp regulates bone development, other LHFP family members have different functions. Notably, mutations in LHFP-like genes cause deafness in both humans and mice, indicating roles in auditory function .

d) Disease associations: Different LHFP family members have been linked to various pathological conditions. The original LHFP was identified as a fusion partner in lipomas, while others connect to hearing disorders .

e) Evolutionary conservation: The family shows conservation across species, suggesting important biological functions maintained throughout evolution .

Comparative studies of different LHFP family members could provide valuable insights into their specific roles in various tissues and developmental processes, potentially revealing shared molecular mechanisms or functional domains.

  • What are the most effective methods for measuring Lhfp expression in bone and osteoblasts?

Several complementary methods have proven effective for measuring Lhfp expression in bone and osteoblasts:

a) Quantitative PCR (qPCR): This technique allows precise relative quantification of Lhfp mRNA levels and is particularly useful for comparing expression between experimental conditions or genotypes. Researchers have successfully used qPCR with specific primers to assess Lhfp expression in bone tissues .

b) Microarray expression analysis: Genome-wide expression profiling using microarrays has been employed to analyze Lhfp expression patterns in bone samples from the Hybrid Mouse Diversity Panel (HMDP). This data is publicly available from NCBI Gene Expression Omnibus (GEO) (GSE27483) .

c) RNA-sequencing: Although not explicitly mentioned in the search results, RNA-seq provides advantages over microarrays, including better dynamic range and the ability to detect novel transcripts and splice variants.

d) Expression quantitative trait loci (eQTL) analysis: This approach connects genetic variation to gene expression levels, providing insights into the genetic regulation of Lhfp across tissues .

e) Network-based expression analysis: Topological Overlap Measures (TOMs) and gene co-expression networks reveal Lhfp's expression relationships with other genes in bone tissue .

f) In situ hybridization: For spatial localization of Lhfp expression within bone tissue, this technique would be valuable though not specifically mentioned in the search results.

For comprehensive characterization, combining multiple approaches is recommended, with qPCR being particularly suitable for targeted analysis of expression levels in specific bone cell populations or experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.