Recombinant Mouse Low affinity immunoglobulin epsilon Fc receptor (Fcer2)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Recombinant Fcer2 is produced using diverse expression systems:

Expression Hosts

  • E. coli: Used for full-length protein production (1-331 aa) with >90% purity .

  • HEK293 Cells: Preferred for glycosylated extracellular domains (e.g., 51-331 aa) with >92% purity .

Functional Roles in Immunology

Fcer2 mediates several immune processes:

  • IgE Regulation: Binds IgE with low affinity, modulating antibody production and B-cell differentiation .

  • Antigen Presentation: Facilitates IgE-dependent antigen uptake by B cells for T-cell activation .

  • Parasite Defense: Triggers nitric oxide production in macrophages upon IgE cross-linking, enhancing intracellular pathogen killing .

Key Uses

  • SDS-PAGE Analysis: Primary application for purity verification .

  • ELISA Quantification: Commercial kits (e.g., Assay Genie MOEB0713) detect Fcer2 in serum/plasma with 39.3 pg/mL sensitivity .

  • Binding Studies: Investigates interactions with IgE, CD21, and integrins .

Experimental Considerations

  • Avoid repeated freeze-thaw cycles; aliquot for long-term storage .

  • Reconstitute in glycerol-containing buffers to enhance stability .

Future Directions

Current research focuses on:

  • Isoform-specific roles in immune regulation (e.g., membrane-bound vs. soluble CD23) .

  • Therapeutic targeting for allergic diseases and autoimmune disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Fcer2; Fcer2a; Low affinity immunoglobulin epsilon Fc receptor; Fc-epsilon-RII; Lymphocyte IgE receptor; CD antigen CD23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEENEYSGYWEPPRKRCCCARRGTQLMLVGLLSTAMWAGLLALLLLWHWETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP
Uniprot No.

Target Background

Function
Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Plays critical roles in regulating IgE production and B-cell differentiation (it is a B-cell-specific antigen).
Gene References Into Functions
  1. Human and murine P2X7 activation induces rapid CD23 shedding from B cells; ADAM10 may play a role in this process. PMID: 25155463
  2. CD23 is sorted into exosomes in an ADAM10-dependent manner. PMID: 20876574
  3. B cells capture IgE via direct binding to the low-affinity IgE receptor, CD23. PMID: 20870945
  4. Mice with disrupted FcεRIα subunit exhibit reduced responses to electrical field stimulation, less airway inflammation and goblet cell hyperplasia, and lower lung IL-13 after 10 days of nebulized ovalbumin challenge. PMID: 15128831
  5. The functions of CD23 splice forms, b and bΔ5, in the apical-to-basolateral transcytosis of IgE/allergen complexes were investigated. PMID: 15702991
  6. A positive internalization signal for IgE transepithelial transport is located in the cytoplasmic region common to all CD23 splice forms. This signal is negatively regulated by the intracellular CD23b-specific exon. PMID: 15843555
  7. Norepinephrine regulates endogenous B cell activity in vivo by stimulating the B cell β2-adrenergic receptor, increasing IgE production in a p38 MAPK- and soluble CD23-dependent manner. PMID: 16920928
  8. These data directly demonstrate CD23's role in regulating IgE production in vivo, suggesting that therapies stabilizing cell surface CD23 could benefit allergic disease control. PMID: 17324389
  9. CD23 is a key regulatory factor for IgE production. PMID: 18828998
Database Links

KEGG: mmu:14128

STRING: 10090.ENSMUSP00000005678

UniGene: Mm.1233

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor.

Q&A

What is the basic structure of mouse FCER2 and how does it compare to human FCER2?

Mouse FCER2 (CD23) is a type II transmembrane glycoprotein belonging to the C-type lectin family. The protein consists of an extracellular domain containing a lectin-like domain responsible for carbohydrate binding and an Ig-like domain involved in receptor dimerization and ligand binding. The structure includes a transmembrane domain and a cytoplasmic tail containing signaling motifs (ITAMs) essential for signal transduction .

While human and mouse FCER2 share functional similarities as low-affinity IgE receptors, the mouse protein has a molecular weight of approximately 16.26 kDa in its recombinant form, which is smaller than its native form due to post-translational modifications . Structurally, both proteins function as cell surface receptors for IgE, but species-specific differences exist in their binding affinities and expression patterns that researchers must consider when translating findings between models.

What are the primary cellular expression patterns of mouse FCER2?

Mouse FCER2 is primarily expressed on the surface of B cells and follicular dendritic cells within the immune system . The expression pattern varies depending on the activation state of these cells, with upregulation occurring during certain immune responses. FCER2 functions as the low-affinity receptor for IgE and plays a critical role in regulating IgE production and allergic responses .

When studying mouse models, researchers should note that FCER2 expression can be modulated by various cytokines and inflammatory mediators, making the timing of tissue collection critical for accurate assessment of expression levels. Flow cytometry using anti-CD23 antibodies remains the gold standard for quantifying cellular expression in mouse tissues.

How do polymorphisms in the FCER2 gene affect asthma outcomes in research models?

Genetic variation in the FCER2 gene has significant implications for asthma outcomes in both human patients and research models. The T2206C variant (rs28364072) has been particularly well-studied, showing associations with increased risk of exacerbations in asthmatic children treated with inhaled corticosteroids . In human studies, the relative risk for exacerbations in those homozygous for the variant allele was 3.95 (95% CI: 1.64–9.51) for Caucasian children and 3.08 (95% CI: 1.00–9.47) for African–American children .

Research examining this variant has demonstrated its association with both differences in IgE levels and differential expression of the FCER2 gene itself . This supports the hypothesis that variation in FCER2 can adversely affect the normal negative feedback mechanisms regulating IgE production, potentially contributing to more severe asthma phenotypes and reduced response to corticosteroid therapy.

When developing mouse models, researchers must consider these polymorphisms when evaluating therapeutic responses, as genetic background significantly influences experimental outcomes.

What associations exist between FCER2 variants and FENO levels in asthma research?

Studies have demonstrated significant associations between FCER2 variants, particularly rs28364072, and Fractional Exhaled Nitric Oxide (FENO) levels in asthmatic subjects . FENO serves as an important biomarker of eosinophilic airway inflammation in asthma research.

Research has shown that genotype categories of FCER2 rs28364072 (homozygous GG, heterozygote GA, and homozygous AA) correlate with different concentrations of FENO . Statistical analysis using Kruskal-Wallis tests has revealed statistically significant differences in FENO levels between these genotype categories, with further pairwise comparisons using Dunn's post hoc tests identifying specific differences between genotype pairs .

These associations provide valuable insights for researchers designing studies to evaluate asthma therapies, suggesting that stratification by FCER2 genotype may help explain variability in therapeutic responses and inflammatory profiles.

What are the optimal conditions for expressing recombinant mouse FCER2 in prokaryotic systems?

When expressing recombinant mouse FCER2 in prokaryotic systems, researchers must optimize several parameters to achieve high-quality protein production. Based on established protocols, the recommended approach includes:

  • Expression System Selection: E. coli BL21(DE3) strains typically yield good expression of mouse FCER2, though codon optimization may be necessary due to differences between mammalian and bacterial codon usage .

  • Temperature and Induction Conditions: Expression at lower temperatures (16-18°C) after induction often improves protein folding compared to standard 37°C conditions.

  • Tag Selection: N-terminal His-tagging (as described in commercial preparations) facilitates purification while minimizing interference with protein folding .

  • Protein Verification: The purity of expressed protein should exceed 85% as determined by SDS-PAGE and Coomassie blue staining .

Note that prokaryotic expression will not reproduce the glycosylation patterns found in native mouse FCER2, which may affect certain functional studies. For applications where post-translational modifications are critical, mammalian expression systems (HEK-293) should be considered as alternatives to prokaryotic systems .

How can researchers effectively measure FCER2 function in mouse models of asthma?

Effective measurement of FCER2 function in mouse asthma models requires a multi-parameter approach:

  • Expression Analysis: Quantitative PCR for FCER2 mRNA and flow cytometry for surface protein expression on B cells and dendritic cells provide baseline measurements.

  • Functional Assays:

    • IgE binding capacity assays using labeled IgE

    • B cell activation studies measuring calcium flux following FCER2 engagement

    • In vitro assays of antigen presentation capacity of FCER2-expressing cells

  • Physiological Parameters:

    • Airway hyperresponsiveness measurements using whole-body plethysmography

    • FENO measurements as a biomarker of eosinophilic inflammation

    • Lung histology for assessment of inflammatory cell infiltration

  • Genotyping: Include analysis of relevant FCER2 polymorphisms (similar to human T2206C variant) that may influence corticosteroid response .

These measurements should be conducted in both baseline conditions and following allergen challenge, with appropriate controls for mouse strain differences that might affect FCER2 expression and function.

How does FCER2 expression modulate response to different asthma therapies in mouse models?

FCER2 expression significantly influences therapeutic responses in asthma models through multiple mechanisms. Research indicates that FCER2 variants alter responses to major classes of asthma medications, including β-agonists, leukotriene modifiers, and inhaled corticosteroids .

The role of FCER2 is particularly critical in corticosteroid response pathways. Studies have demonstrated that specific FCER2 variants are associated with increased risk of exacerbations in subjects taking inhaled corticosteroids, despite the generally protective effects of these medications . The T2206C variant specifically has been associated with a hazard ratio of 3.95 for exacerbations in Caucasian patients homozygous for the variant allele .

For leukotriene receptor antagonists (LTRAs), FCER2 polymorphisms have been associated with differential prescribing patterns and clinical responses, suggesting genotype-specific efficacy . When designing mouse model studies to evaluate asthma therapies, researchers should consider FCER2 genotype as a potential modifier of treatment response, particularly when evaluating steroid resistance or variability in LTRA efficacy.

What are the implications of shared FCER2 genetic associations between asthma and COPD for research models?

Recent research suggests that FCER2 gene polymorphisms demonstrate positive associations with susceptibility to both COPD and asthma, supporting aspects of the "Dutch hypothesis" that these conditions may share common genetic origins . This finding has significant implications for research models exploring the relationship between these respiratory conditions.

Specifically, haplotypes of the FCER2 gene have been associated with pulmonary function measurements and blood eosinophil counts in both diseases . This suggests that FCER2-mediated pathways may represent a mechanistic link between certain phenotypes of asthma and COPD, particularly those characterized by eosinophilic inflammation.

These shared genetic associations raise intriguing possibilities for therapeutic approaches. The findings suggest that anti-IgE biologics, already established as effective treatments for allergic asthma, might potentially benefit specific COPD subtypes characterized by FCER2-associated pathways . When developing mouse models to study overlap syndromes or evaluate novel therapeutics, researchers should consider incorporating FCER2 genotyping to identify phenotypes that might respond to targeted therapies addressing shared pathways.

What controls should be included when studying FCER2 function in transgenic mouse models?

When designing experiments with transgenic mouse models to study FCER2 function, comprehensive controls are essential:

  • Genetic Background Controls:

    • Wild-type littermates from the same breeding pairs

    • Age and sex-matched controls

    • If backcrossed, include controls from both original and recipient strains

  • Expression Validation Controls:

    • Quantitative analysis of FCER2 mRNA expression across relevant tissues

    • Protein expression confirmation via Western blot and flow cytometry

    • Immunohistochemistry to verify tissue-specific expression patterns

  • Functional Controls:

    • Isolated B cells from wild-type mice to establish baseline FCER2 function

    • Positive controls using established FCER2 ligands

    • Negative controls using FCER2 knockout models where available

  • Pharmacological Controls:

    • Vehicle controls for all interventions

    • Dose-response curves for FCER2-targeting compounds

    • Positive control compounds with established effects on FCER2 pathways

When publishing results, researchers should provide detailed information about control selection rationale and validation methods to ensure experimental rigor and reproducibility.

How should researchers address potential discrepancies between human and mouse FCER2 studies?

Addressing discrepancies between human and mouse FCER2 studies requires systematic approaches:

  • Sequence and Structure Analysis:

    • Conduct comparative sequence analysis between human and mouse FCER2

    • Identify conserved domains versus divergent regions

    • Evaluate functional implications of structural differences

  • Expression Pattern Documentation:

    • Map tissue-specific expression patterns in both species

    • Document developmental differences in expression

    • Compare regulation of expression by cytokines and inflammatory mediators

  • Functional Comparison Studies:

    • Design parallel assays testing the same parameters in human and mouse systems

    • Use humanized mouse models where appropriate

    • Employ in vitro systems with both human and mouse cells under identical conditions

  • Data Analysis Framework:

    • Develop clear criteria for determining whether discrepancies reflect species differences or experimental variables

    • Use statistical approaches that account for different scales and variability between human and mouse data

    • Consider meta-analysis approaches when comparing across multiple studies

When discrepancies are identified, researchers should avoid overgeneralizing findings from one species to another and explicitly discuss the implications for translational research in their publications.

What are the emerging areas of research involving FCER2 in precision medicine approaches to asthma?

Emerging research on FCER2 is opening new frontiers in precision medicine approaches to asthma management. Several promising directions include:

  • Pharmacogenetic Biomarker Development: FCER2 variants show potential as predictive biomarkers for response to corticosteroids and leukotriene modifiers . Future research is focusing on developing clinically applicable tests that can guide therapeutic selection based on FCER2 genotype.

  • Targeted Therapeutics: Understanding the mechanistic relationships between FCER2 variants and treatment response provides opportunities to develop drugs specifically targeting altered pathways in patients with specific genotypes.

  • Integration with Other Genetic Markers: Research is moving toward creating comprehensive genetic profiles that incorporate FCER2 along with other relevant genetic markers to provide more accurate prediction of asthma phenotypes and treatment responses.

  • Developmental Timing Studies: Investigating how FCER2 expression and function changes during lung development could reveal critical windows for intervention in at-risk populations.

The identification of FCER2 genetic variants that associate with asthmatic drug response offers both prognostic assistance in determining response to existing therapy and potential targets for developing novel pharmacologic agents .

How might single-cell analysis techniques advance understanding of FCER2 function in immune regulation?

Single-cell analysis techniques offer transformative potential for understanding FCER2's role in immune regulation:

  • Cell-Specific Expression Profiling: Single-cell RNA sequencing can identify previously unrecognized cell populations expressing FCER2 and reveal heterogeneity within B cell and dendritic cell populations.

  • Functional Dynamics: Technologies like mass cytometry (CyTOF) and spectral flow cytometry enable simultaneous assessment of FCER2 expression alongside multiple signaling molecules, providing insights into how FCER2 integrates with other immune pathways.

  • Spatial Context Analysis: Techniques such as Imaging Mass Cytometry and Multiplexed Ion Beam Imaging can map FCER2 expression within tissue microenvironments, revealing interactions with other cell types that influence immune regulation.

  • Temporal Dynamics: Single-cell trajectory analysis can track changes in FCER2-expressing cells during immune responses, identifying key transition states during allergic sensitization or tolerance development.

These approaches will help elucidate how FCER2 functions within complex immune networks, potentially revealing new therapeutic targets for modulating IgE-mediated immune responses in allergic diseases and asthma.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.