Recombinant Mouse Lymphotoxin-beta (Ltb)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ltb; Tnfc; Tnfsf3; Lymphotoxin-beta; LT-beta; Tumor necrosis factor C; TNF-C; Tumor necrosis factor ligand superfamily member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ltb
Target Protein Sequence
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG
Uniprot No.

Target Background

Function
Lymphotoxin-beta is a cytokine that binds to LTBR/TNFRSF3. It may play a crucial role in regulating immune responses. It serves as the membrane anchor for the attachment of the heterotrimeric complex to the cell surface.
Gene References Into Functions
  1. Lymphotoxin (LT)-B expression was significantly downregulated in the absence of T cells from nude mice and was restored after the transfusion of T cells. PMID: 25266629
  2. TNF upregulates LT-beta expression in hepatic cells at the transcriptional level by the binding of NF-kappaB p50/p65 heterodimers and Ets1 to their respective sites in the LT-beta promoter. PMID: 22742857
  3. Lymphotoxin-beta-receptor (LTbetaR) signaling, a pathway essential for lymphoid organogenesis, inhibits tertiary lymphoid organ development in heart transplantation. PMID: 21926237
  4. LTbeta RNA is detectable in embryos ranging from 5.5 to 18.5 days of development, e.g., in peripheral lymph nodes, Peyer's patches, thymus and skin of the E18.5 embryo and fetal liver of E12.5. PMID: 11994460
  5. Membrane lymphotoxin beta contributes to anti-leishmanial immunity by controlling the structural integrity of lymphoid organs. PMID: 12115620
  6. The organogenic function of B-LTbeta is primarily restricted to the spleen, where it supports the correct lymphoid architecture that is crucial for an effective humoral immune response. PMID: 12354378
  7. The microenvironment in peripheral lymphoid organs, associated with lymphotoxin alpha/lymphotoxin beta-lymphotoxin beta receptor signaling and chemokine production, is critical for the efficient recruitment of dendritic cells. PMID: 12560241
  8. Membrane LT-beta plays a significant role in resistance to Theiler's virus infection. PMID: 12882833
  9. Lymphotoxin-mediated adhesion molecule expression may be important in the development of graft-versus-host skin disease. PMID: 14734744
  10. LTbeta, LTbeta receptor, and IFNgamma are involved in oval cell-mediated, but not hepatocyte-mediated, liver regeneration, and the absence of these pathways impairs the oval cell-dependent regenerative response. PMID: 15660390
  11. The lymphotoxin beta signaling pathway is an essential effector pathway for host defense against the beta-herpesvirus muromegalovirus (MCMV). PMID: 15905567
  12. Data indicate that, as an ectodysplasin target, lymphotoxin-beta regulates hair phenotype in developing hair follicles. PMID: 16738056
  13. Expression of LTbeta on lymphocytes enhances the induction of immune responses against limiting amounts of antigen. PMID: 16841297
  14. Expression of lymphotoxin-alphabeta on antigen-specific T cells is essential for DC function. PMID: 17452522
  15. Activation of LTbetaR by LTalphabeta, primarily expressed on T lymphocytes, is crucial for downregulating the inflammatory response in this experimental model. PMID: 17590442
  16. LTbeta exhibits a primary early function in periderm differentiation, with subsequent transient effects on epidermal and hair follicle differentiation. PMID: 17673451
  17. LTbeta signaling was essential for primary B cell cluster formation with the initial differentiation of follicular dendritic cells (FDCs) in neonatal mice. PMID: 17982070
  18. LTbetaR on hepatic stellate cells may be involved in signaling with LTbeta-expressing liver progenitor cells, mediating the recruitment of progenitor cells, hepatic stellate cells, and leukocytes for wound healing and regeneration during chronic liver injury. PMID: 19111021

Show More

Hide All

Database Links

KEGG: mmu:16994

STRING: 10090.ENSMUSP00000025262

UniGene: Mm.1715

Protein Families
Tumor necrosis factor family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the molecular structure of mouse Lymphotoxin-beta?

Mouse Lymphotoxin beta (LT-beta) is a type II membrane protein consisting of 306 amino acids with a 27 amino acid N-terminal cytoplasmic domain, a 21 amino acid transmembrane region, and a 258 amino acid extracellular domain. It shares approximately 73% amino acid sequence identity with human LT-beta within common regions of their extracellular domains. Unlike soluble LT-alpha, LT-beta is primarily membrane-associated and forms functional heterotrimers with LT-alpha .

What complexes does Lymphotoxin-beta form, and what is their significance?

Lymphotoxin-beta associates with secreted LT-alpha to form two distinct heterotrimeric complexes: LT alpha1/beta2 (the predominant form) and LT alpha2/beta1. The composition of these complexes determines their receptor specificity. The LT alpha1/beta2 heterotrimer binds exclusively to the Lymphotoxin-beta receptor (LT-beta R), while LT alpha2/beta1 can bind to LT-beta R as well as TNF RI (p55) and TNF RII (p75). This differential binding is critical in experimental design as it leads to distinct downstream signaling pathways and biological effects .

How does mouse Lymphotoxin-beta compare to its human counterpart?

Mouse LT-beta shares 73% amino acid sequence identity with human LT-beta within the common regions of their extracellular domains. Similarly, the mouse LT-beta receptor exhibits 76% identity to the human LT-beta receptor. These similarities enable cross-species extrapolation in many experimental contexts, but researchers should remain aware of species-specific differences that may affect binding affinities, signaling kinetics, and downstream responses when designing translational studies .

What controls the expression of Lymphotoxin-beta at the transcriptional level?

The LT-beta promoter region contains several conserved transcription factor binding sites, including Egr-1, NF-kappaB, and Ets binding sites. Studies using promoter-reporter constructs have demonstrated that PMA-induced expression requires intact Ets and NF-kappaB sites, suggesting cooperative interaction between these transcription factors. Mutations at either site dramatically reduce PMA-inducible promoter activity. The Egr-1 site also contributes significantly to promoter activity, with residual activity attributed to binding of constitutively expressed Sp-1 at the same site. This information is critical for researchers designing experiments to modulate LT-beta expression .

What is the tissue distribution of Lymphotoxin-beta and its receptor?

Lymphotoxin-beta is predominantly expressed in lymphoid cells and organs, particularly by activated T cells. In contrast, the LT-beta receptor is expressed more broadly, with high expression in stromal cells and fibroblasts and lower expression on myeloid cell lines. The receptor is constitutively expressed in visceral and lymphoid tissues but notably absent on CTL lines. This differential expression pattern is important for understanding LT-beta-mediated intercellular communication in experimental systems .

How can I experimentally induce Lymphotoxin-beta expression?

Lymphotoxin-beta expression can be induced in appropriate cell lines (such as Jurkat cells) using phorbol myristate acetate (PMA). This induction occurs at the transcriptional level and is not significantly affected by cycloheximide treatment, suggesting direct activation rather than dependency on de novo protein synthesis. When designing experiments to study LT-beta function, researchers can use this PMA-induction system as a reliable method to upregulate expression in a controlled manner .

What role does Lymphotoxin-beta play in lymphoid organogenesis?

Lymphotoxin-beta, particularly as part of the LT alpha1/beta2 heterotrimer, is crucial for normal lymphoid organogenesis. It interacts with the LT-beta receptor expressed on specialized stromal cells to promote the development of follicular dendritic cell (FDC) networks and high endothelial venules (HEV) in lymphoid tissue. This interaction also facilitates the class switching of immature B cells for IgA production and production of homeostatic IL-22 by innate lymphoid cells (ILCs). Researchers studying lymphoid tissue development should consider the LT-beta pathway as a critical component of organogenesis and immune architecture formation .

What are the optimal conditions for reconstituting and storing recombinant mouse Lymphotoxin-beta proteins?

Recombinant mouse Lymphotoxin proteins (such as LT alpha1/beta2) are typically supplied as lyophilized preparations. For optimal results:

  • Reconstitute lyophilized proteins at 500 μg/mL in PBS

  • For carrier-free versions, reconstitute directly in PBS without additives

  • Upon receipt, immediately store according to manufacturer recommendations

  • Minimize freeze-thaw cycles to maintain bioactivity

When using these proteins in bioassays or cell culture, researchers should validate the activity of each lot, as biological potency may vary between preparations .

How can I measure the biological activity of recombinant mouse Lymphotoxin-beta complexes?

The biological activity of recombinant mouse Lymphotoxin complexes can be measured using several established assays:

Assay TypeMethodExpected ResultsNotes
Cell ProliferationNIH-3T3 mouse embryonic fibroblast proliferationED50: 0.3-2.1 ng/mL for LT alpha1/beta2Most commonly used potency measure
Receptor BindingLT-beta R-Fc chimera binding assayConcentration-dependent bindingConfirms functional heterotrimer formation
NF-κB ActivationReporter cell assaysED50: 15-75 ng/mL (with 10 ng/mL LT alpha1/beta2)Demonstrates downstream signaling

These assays provide complementary information about the functionality of recombinant LT complexes and should be selected based on the specific research question .

What controls should I include when studying Lymphotoxin-beta signaling in T cell response assays?

When conducting T cell response assays involving Lymphotoxin-beta:

  • Include anti-CD3 antibody (5 μg/ml) as a positive control for T cell activation

  • Include background wells without antigen

  • For antigen-specific responses, use varying concentrations of the relevant peptide (e.g., MBP-peptide or PLP 139-151)

  • Measure both proliferation (via 3H thymidine incorporation) and cytokine production

  • Consider including LT-beta pathway inhibitors (such as LT-beta R-Fc fusion proteins) to confirm pathway specificity

These controls help distinguish LT-beta-specific effects from general T cell activation and provide robust validation of experimental findings .

How do the different forms of Lymphotoxin heterotrimers affect experimental outcomes?

The composition of Lymphotoxin heterotrimers significantly impacts experimental outcomes due to their differential receptor binding profiles:

  • LT alpha3 (homotrimer): Binds both TNF RI (p55) and TNF RII (p75)

  • LT alpha1/beta2 (heterotrimer): Binds exclusively to LT-beta R

  • LT alpha2/beta1 (heterotrimer): Binds LT-beta R, TNF RI, and TNF RII

When designing blocking or stimulation experiments, researchers must carefully consider which complex they're targeting. For example, using LT-beta R-Fc fusion proteins will block signaling through LT alpha1/beta2 and LT alpha2/beta1, but not LT alpha3. Similarly, knockout or silencing approaches targeting LT-beta will affect heterotrimers but not LT alpha3 function. This complexity requires precise experimental design and interpretation .

What are the methodological challenges in distinguishing Lymphotoxin-beta effects from other TNF family members?

Several methodological challenges exist when studying LT-beta-specific effects:

  • Receptor cross-reactivity: LT-beta receptor also serves as a receptor for LIGHT/TNFSF14

  • Heterotrimer composition: Various LT complexes have overlapping functions

  • Receptor expression patterns: LT-beta R is expressed on multiple cell types

  • Developmental vs. acute effects: LT-knockout mice have developmental defects that confound interpretation

To address these challenges, researchers should:

  • Use specific blocking antibodies or fusion proteins that target particular interactions

  • Employ inducible or conditional knockout models to separate developmental from functional effects

  • Include appropriate controls for related TNF family members

  • Consider using fusion protein decoys that block the LT pathway without causing developmental defects

How does proteolytic processing affect Lymphotoxin-beta function in experimental systems?

Lymphotoxin heterotrimers can undergo proteolytic processing that affects their function. The LT alpha1/beta2 heterotrimer can be shed by ADAM17 or MMP-8 mediated cleavage, releasing soluble heterotrimers that circulate in serum. These shed complexes retain biological activity but have altered biodistribution compared to membrane-bound forms. In certain inflammatory conditions, such as rheumatoid arthritis, levels of these shed heterotrimers are elevated in synovial fluid.

Researchers should consider this processing when:

  • Interpreting results from in vivo experiments where proteases may be active

  • Designing inhibitor studies targeting membrane vs. soluble forms

  • Analyzing patient samples for biomarker studies

  • Developing recombinant proteins resistant to proteolytic processing

Protease inhibitors or protease-resistant mutants can be employed to control for these effects in experimental systems .

What techniques can be used to verify the quality of recombinant mouse Lymphotoxin-beta proteins?

Quality verification of recombinant mouse Lymphotoxin-beta proteins should include:

  • SDS-PAGE analysis under both reducing and non-reducing conditions to verify molecular weight and oligomeric status (expect bands at 42-63 kDa for LT alpha1/beta2)

  • Western blotting with specific antibodies to confirm identity

  • Endotoxin testing to ensure preparations are suitable for in vivo use

  • Biological activity assays (as described in section 4.2)

  • Mass spectrometry to confirm protein integrity and post-translational modifications

These quality control steps are essential before using recombinant proteins in critical experiments, particularly those involving in vivo administration or primary cell cultures .

How can I differentiate between effects mediated by Lymphotoxin-beta versus other related cytokines?

To differentiate between effects mediated by Lymphotoxin-beta versus related cytokines:

  • Use specific blocking antibodies such as anti-mouse Lymphotoxin beta Receptor (clone 5G11b)

  • Employ recombinant receptor-Fc fusion proteins that selectively bind particular ligands

  • Design experiments with cells from specific knockout mice (LT-alpha KO vs. LT-beta KO)

  • Utilize siRNA or CRISPR-based approaches to selectively silence specific pathway components

  • Perform receptor expression analysis on target cells to determine which signaling pathways are available

This approach allows researchers to delineate the specific contributions of LT-beta in complex biological systems where multiple TNF family members may be active .

What are the optimal experimental designs for studying Lymphotoxin-beta in autoimmune disease models?

When studying Lymphotoxin-beta in autoimmune disease models, researchers should consider:

  • Model selection: Choose models that don't require pertussis toxin when studying LT-beta effects, as pertussis toxin can mask LT-dependent phenotypes

  • Timing of intervention: LT-beta plays roles in both development and effector phases of immune responses

  • Readout selection:

    • T cell proliferation assays with antigen rechallenge

    • Cytokine production profiles

    • Histological assessment of target tissues

    • Flow cytometric analysis of infiltrating immune cells

  • Controls: Include both isotype controls and functionally relevant controls (e.g., TNF inhibitors)

  • Genetic background: The impact of LT-beta manipulation may vary between mouse strains

These considerations help ensure robust and reproducible results when investigating LT-beta's role in autoimmune pathology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.