Recombinant Mouse Lysocardiolipin acyltransferase 1 (Lclat1)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Mouse Lysocardiolipin Acyltransferase 1 (Lclat1) is a genetically engineered protein derived from the LCLAT1 gene in mice. It is produced via heterologous expression systems, such as E. coli, and retains enzymatic activities critical for phospholipid remodeling. Key features include:

  • UniProt ID: Q3UN02

  • Expression System: E. coli (in vitro)

  • Tag: N-terminal 10xHis-tag for purification

  • Protein Length: Full-length (1-376 amino acids)

Lclat1 catalyzes the reacylation of lysocardiolipin (lyso-CL) to cardiolipin (CL), a phospholipid essential for mitochondrial membrane integrity and energy production. It also exhibits acyltransferase activity toward other polyglycerophospholipids, such as lysophosphatidylglycerol (LPG) and bis(monoacylglycero)phosphate (BMP) .

Enzymatic Function and Substrate Specificity

Lclat1 exhibits dual enzymatic activities:

  1. Acyl-CoA:Lysocardiolipin Acyltransferase (ALCAT):

    • Reacylates monolysocardiolipin (MLCL) and dilysocardiolipin (DLCL) to CL, using linoleoyl-CoA and oleoyl-CoA as preferred acyl donors .

    • Critical for maintaining CL’s unique acyl composition (e.g., C18:2 linoleate chains) .

  2. 1-Acyl-sn-Glycerol-3-Phosphate Acyltransferase (AGPAT):

    • Converts lysophosphatidic acid (LPA) to phosphatidic acid (PA) at the sn-2 position .

Table 2: Substrate Selectivity and Inhibitors

ParameterDetails
SubstratesMLCL, DLCL, LPG, BMP
Non-SubstratesLPC, LPE, LPS, lyso-PAF, LPI
InhibitorsATP, ADP (potent inhibition)

Regulation by Thyroid Hormone

  • Hypothyroidism: Lclat1 mRNA expression decreases by 48% in heart and 33% in liver .

  • Hyperthyroidism: Expression upregulates in response to T4 treatment, correlating with mitochondrial oxidative stress .

Role in Disease Pathways

  • Barth Syndrome: Linked to CL deficiency; Lclat1 dysfunction may impair CL remodeling .

  • Mitochondrial Dysfunction: CL depletion disrupts ATP/ADP carrier proteins, affecting energy metabolism .

Applications in Research

Recombinant Lclat1 is used to:

  1. Study Cardiolipin Remodeling: Investigate substrate preference and enzyme kinetics .

  2. Model Metabolic Disorders: Analyze CL biosynthesis in Barth Syndrome or pulmonary fibrosis .

  3. Elucidate Mitochondrial Stress Responses: Examine interplay between ATP/ADP levels and CL composition .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Lclat1; Agpat8; Alcat1; Gm91; Lycat; Lysocardiolipin acyltransferase 1; 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-AGP acyltransferase 8; 1-AGPAT 8; Acyl-CoA:lysocardiolipin acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lclat1
Target Protein Sequence
MVSWKGIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLET MFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRYSYLRVEKICLKSSLKSVPG FGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDF AEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPYNIPQTEKHLLLGDFP KEIHFHVQRYPADSLPTSKEDLQLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKS ELRVLVVKLLSIVYWALFCSAMCLLIYLYSPVRWYFIISIVFFVLQERIFGGLEIIELAC YRFLHKHPHLNSKKNE
Uniprot No.

Target Background

Function
Recombinant Mouse Lysocardiolipin acyltransferase 1 (Lclat1) exhibits acyl-CoA:lysocardiolipin acyltransferase (ALCAT) activity. It catalyzes the reacylation of lyso-cardiolipin to cardiolipin (CL), a crucial step in CL remodeling. Lclat1 recognizes both monolysocardiolipin and dilysocardiolipin as substrates, with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Additionally, it possesses 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT) activity, converting 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Lclat1 also exhibits lysophosphatidylinositol acyltransferase (LPIAT) activity and lysophosphatidylglycerol acyltransferase (LPGAT) activity. Lclat1 is essential for the establishment of hematopoietic and endothelial lineages.
Gene References Into Functions
  1. Lycat regulates TGF-beta mediated lung fibroblast differentiation in pulmonary fibrosis. PMID: 28751023
  2. Alcat1 is destabilized in epithelia by lipopolysaccharide (LPS), impairing mitochondrial function. PMID: 26604221
  3. Differential reduction in cardiac and liver monolysocardiolipin acyltransferase-1 and reduction in cardiac and liver tetralinoleoyl-cardiolipin in the alpha-subunit of trifunctional protein heterozygous knockout mice PMID: 26251360
  4. Pathological cardiolipin remodeling by ALCAT1 linked to the pathogenesis of nonalcoholic fatty liver diseases PMID: 25203315
  5. LYCAT expression was altered in peripheral blood mononuclear cells and outcome in pulmonary fibrosis. PMID: 24779708
  6. Findings implicate a key role of ALCAT1 as the missing link between oxidative stress and mitochondrial dysfunction in the etiology of age-related heart diseases PMID: 22949503
  7. Data indicate that LYCAT is a determinant of PI molecular species, and its function is conserved in C. elegans and mammals. PMID: 22172515
  8. ALCAT1 deficiency prevented the onset of DIO and significantly improved mitochondrial complex I activity, lipid oxidation, and insulin signaling. PMID: 20674860
  9. Expression of Lclat1 gene in the mouse cardiovascular system is reported. PMID: 20503378
  10. Includes the study of an upstream ORF in this gene and shows that it functions to reduce protein levels by ~40%. PMID: 19372376
  11. Identification and characterization of a gene that encodes an acyl-CoA:lysocardiolipin acyltransferase 1 PMID: 15152008
  12. Mouse Lycat plays an important role in the early specification of hematopoietic and endothelial cells. PMID: 17675553
  13. A regulatory role of ALCAT1 in cardiolipin remodeling in response to oxidative stress. ALCAT1 expression in liver and heart was significantly downregulated in mice with hypothyroidism and upregulated in mice treated with thyroid hormone. PMID: 19106248

Show More

Hide All

Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with highest expression in heart, liver and E12.5 aorta-gonad-mesonephros and lower levels in the E16 fetal liver and adult bone marrow. In bone marrow, highest levels are found in B-cells compared with whole bone marrow, T-cells, erythro

Q&A

What is Recombinant Mouse Lysocardiolipin acyltransferase 1 (Lclat1) and what is its primary function?

Lysocardiolipin acyltransferase 1 (Lclat1), also known as acyl-CoA:lysocardiolipin acyltransferase-1 (ALCAT1), is an enzyme that catalyzes the acylation of lysocardiolipin back to cardiolipin, representing a critical step in the cardiolipin remodeling process. This enzyme facilitates the transfer of fatty acyl groups from acyl-CoA to lysocardiolipin, which exists in two forms: monolysocardiolipin (MLCL) and dilysocardiolipin (DLCL). The remodeling process is essential for achieving the unique acyl composition of cardiolipin, which is dominated by linoleoyl groups (C18:2), as enzymes in the cardiolipin biosynthetic pathway lack appropriate substrate selectivity . This remodeling function is particularly important in tissues with high mitochondrial activity such as liver and heart, where ALCAT1 is predominantly expressed .

What substrate specificity does Lclat1 demonstrate?

Lclat1 exhibits remarkable substrate versatility beyond its primary function with lysocardiolipin. Research demonstrates that recombinant ALCAT1 catalyzes acylation of multiple members of the polyglycerophospholipid family. These substrates include:

  • Monolysocardiolipin (MLCL) and dilysocardiolipin (DLCL)

  • Lysophosphatidylglycerol (LPG)

  • Bis(monoacylglycero)phosphate (BMP), a structural isomer of lysophosphatidylglycerol

  • Lysophosphatidylinositol (LPI)

  • Lysophosphatidic acid (LPA)

These substrates share a common characteristic: they are anionic lysophospholipids. With the exception of LPA, ALCAT1 appears to recognize primarily lysopolyglycerophospholipids as substrates. Notably, when substrates were substituted with a non-glycerol head on the phosphate group, they were no longer recognized by ALCAT1 . This substrate diversity suggests Lclat1 plays broader roles in phospholipid metabolism beyond cardiolipin remodeling.

How does the structure of Lclat1 relate to its function?

Lclat1 is a positively charged protein with an isoelectric point of 8.5, which corresponds well with its interaction with negatively charged substrates like cardiolipin. Through structural and functional studies, researchers have identified critical amino acids involved in substrate binding, particularly D168 and L169, which are potentially involved in lysophospholipid substrate binding . These amino acids may provide the molecular basis for the substrate selectivity of Lclat1. Additionally, the enzyme demonstrates strong resistance to alkaline conditions, maintaining activity even at pH 11.0, which may reflect the intrinsic properties of the enzyme and its substrates . Unlike mitochondrial MLCL acyltransferase, Lclat1 does not require the integrity of the subcellular membrane for its activity, as treatment with detergents like CHAPS or Triton X-100 actually stimulates rather than inhibits its activity .

How is Lclat1 expression and activity regulated by physiological factors?

Lclat1 expression and activity are significantly modulated by thyroid hormone status, suggesting a regulatory mechanism linked to mitochondrial function and oxidative stress. Research reveals:

  • Thyroid hormone upregulation: Hepatic and cardiac expression of ALCAT1 mRNA is significantly elevated in mice pretreated with thyroid hormone (T₄) compared to control mice. This upregulation corresponds with increased heart weight and heart weight-to-body weight ratio in T₄-treated mice .

  • Hypothyroidism downregulation: Conversely, ALCAT1 mRNA expression decreased by 48% in heart tissue and 33% in liver tissue in mice with hypothyroidism induced by propylthiouracil (PTU) treatment .

  • Correlation with enzyme activity: Consistent with changes in ALCAT1 mRNA expression, cardiac MLCL AT activity increased by 60% in hyperthyroid rats treated with T₄ and decreased by 35% in hypothyroid rats .

This bidirectional regulation by thyroid status suggests that Lclat1 expression adapts to the metabolic demands of tissues, increasing when mitochondrial activity and ROS production are elevated (as in hyperthyroidism) and decreasing under reduced metabolic conditions (as in hypothyroidism).

What is the relationship between Lclat1 and mitochondrial function in oxidative stress?

Lclat1 appears to play a crucial role in the response to oxidative stress, particularly in tissues with high mitochondrial activity. Cardiolipin is exceptionally vulnerable to oxidative damage by reactive oxygen species (ROS) due to its high content of polyunsaturated fatty acids and its proximity to ROS production sites in the mitochondria . The cardiolipin remodeling process catalyzed by Lclat1 is believed to serve as a repair mechanism for oxidative damage to cardiolipin's side chains (lipid peroxidation).

Hyperthyroidism and hypothyroidism have been shown to reciprocally affect oxidative stress levels, lipid peroxidation, and cardiolipin synthesis and remodeling . The upregulation of ALCAT1 expression in hyperthyroidism suggests that increased ALCAT1 activity fulfills the heightened need for cardiolipin remodeling in response to elevated mitochondrial activity and ROS levels associated with this condition. Similarly, downregulation in hypothyroidism corresponds with reduced metabolic activity and oxidative stress . This relationship positions Lclat1 as a potential therapeutic target in diseases characterized by mitochondrial dysfunction and oxidative stress.

How does Lclat1 activity interact with mitochondrial energy metabolism?

An intriguing aspect of Lclat1 regulation is its negative modulation by ATP and ADP, key nucleotides in mitochondrial energy metabolism. Recombinant ALCAT1 is potently inhibited by ADP and ATP, but not by adenosine nucleotide analogs or other nucleotides such as UTP and GTP . This suggests that ALCAT1 does not require ATP hydrolysis for its enzyme activity, but rather is subject to feedback inhibition by these energy molecules.

This inhibitory effect of ATP on ALCAT1 enzyme activity could serve as a feedback response to increased mitochondrial activity by modulating the acyl composition of cardiolipin. Cardiolipin is required for the reconstituted activity of numerous metabolic enzymes involved in oxidative phosphorylation, including ATP/ADP carrier proteins . Consequently, cardiolipin deficiency results in mitochondrial dysfunction and reduced ATP production. The regulation of ALCAT1 by ATP/ADP could therefore represent a homeostatic mechanism linking energy metabolism to cardiolipin remodeling, and by extension, to mitochondrial function and cell survival pathways .

What are the optimal conditions for assaying Lclat1 enzyme activity?

Based on research with recombinant ALCAT1, the following conditions have been established for optimal enzyme activity assessment:

  • pH preference: Recombinant ALCAT1 exhibits an optimum pH of 7.0 but shows strong resistance to alkaline conditions, maintaining activity even at pH 11.0 .

  • Cation requirements: ALCAT1 does not require divalent cations for its enzymatic activity, distinguishing it from some other acyltransferases .

  • Membrane integrity: Unlike some membrane-bound enzymes, ALCAT1 does not require the integrity of the subcellular membrane for its activity. In fact, treatment with detergents like 2% CHAPS or Triton X-100 stimulates ALCAT1 activity rather than inhibiting it .

  • Substrate concentrations: For optimal assay conditions, studies have used 20 μM [¹⁴C]oleoyl-CoA as acyl donor and various lysophospholipids at 200 μM as acyl acceptors .

  • Inhibitory factors: ATP and ADP potently inhibit ALCAT1 enzyme activity, which should be considered when designing assay conditions .

These parameters provide a methodological framework for researchers studying Lclat1 activity in various experimental contexts.

What expression systems are effective for producing recombinant Lclat1?

Research indicates that recombinant Lclat1/ALCAT1 can be successfully expressed in multiple systems:

  • Insect cell expression: Recombinant ALCAT1 has been effectively expressed in Sf9 insect cells, which provided sufficient enzyme for biochemical characterization studies .

  • Mammalian cell expression: Human embryonic kidney 293 (HEK293) cells overexpressing human ALCAT1 have demonstrated significant increases in related acyltransferase activities, making this system viable for functional studies .

  • Expression verification: When expressing recombinant Lclat1, functional verification can be performed by measuring acyltransferase activities toward various substrates, including MLCL, DLCL, LPI, and LPG .

The choice of expression system may depend on the specific research questions being addressed, with insect cells potentially offering higher protein yields for biochemical studies and mammalian cells providing a more physiologically relevant context for functional studies.

How can researchers analyze the substrate specificity of Lclat1?

To comprehensively analyze Lclat1 substrate specificity, researchers can employ the following methodological approach:

  • Radiolabeled assays: Acyltransferase reactions can be carried out using radiolabeled acyl donors (e.g., [¹⁴C]oleoyl-CoA at 20 μM) and various lysophospholipids (at 200 μM) as acyl acceptors. The formation of radiolabeled products indicates substrate recognition by the enzyme .

  • Substrate panel testing: Systematically test a panel of potential substrates including MLCL, DLCL, LPG, lyso-BMP, LPC, LPE, LPS, lyso-PAF, LPI, and LPA to determine the full range of substrate specificity .

  • Structural analysis: Compare the structures of recognized versus unrecognized substrates to identify critical structural features required for enzyme recognition. For example, research has shown that Lclat1 recognizes anionic lysophospholipids, particularly lysopolyglycerophospholipids .

  • Kinetic analysis: Perform enzyme kinetics studies to determine the relative affinities (Km values) and maximum velocities (Vmax) for different substrates. This can reveal preferential substrates and provide insights into the catalytic mechanism .

  • Site-directed mutagenesis: Modify key amino acids potentially involved in substrate binding (such as D168 and L169) to confirm their role in substrate recognition and specificity .

This multifaceted approach allows for a comprehensive characterization of Lclat1's substrate preferences and the structural basis for its specificity.

What is the significance of Lclat1 in metabolic disease research?

Lclat1/ALCAT1 has significant relevance to metabolic disease research due to its role in cardiolipin remodeling and response to oxidative stress. Defective cardiolipin remodeling is associated with various metabolic diseases characterized by increased levels of reactive oxygen species . The regulation of Lclat1 expression by thyroid hormone status provides a model system to study how mitochondrial phospholipid metabolism adapts to altered metabolic states.

Cardiolipin is particularly sensitive to oxidative damage by ROS because of its high content of polyunsaturated fatty acids and its location near ROS production sites. The remodeling process catalyzed by Lclat1 is believed to repair this oxidative damage and prevent the accumulation of peroxidized cardiolipin . This positions Lclat1 as a potential therapeutic target in diseases characterized by mitochondrial dysfunction and oxidative stress, including thyroid disorders, cardiovascular diseases, and neurodegenerative conditions.

How does Lclat1 contribute to cardiolipin homeostasis and cellular function?

Lclat1 contributes to cardiolipin homeostasis through multiple mechanisms that impact cellular function:

  • Reacylation to prevent lysocardiolipin accumulation: The reacylation of lysocardiolipin back to cardiolipin prevents the accumulation of monolysocardiolipin (MLCL), which has been shown to cause apoptosis by binding to the proapoptotic factor tBid .

  • Achievement of optimal fatty acid composition: The remodeling process is essential to achieve the unique acyl composition of cardiolipin's four fatty acyl chains, which is typically restricted to C₁₈ chains dominated by linoleoyl groups (C18:2) .

  • Repair of oxidative damage: Lclat1-mediated remodeling repairs damage to cardiolipin's double bonds (lipid peroxidation) caused by oxidative stress .

  • Energy metabolism regulation: Through its inhibition by ATP/ADP, Lclat1 activity may be linked to cellular energy status, potentially providing a feedback mechanism between energy metabolism and membrane phospholipid composition .

  • Broader phospholipid metabolism: By catalyzing the acylation of other polyglycerophospholipids like PG (a precursor for cardiolipin synthesis) and BMP, Lclat1 may influence multiple aspects of cellular phospholipid metabolism beyond just cardiolipin remodeling .

These diverse functions position Lclat1 as a central player in mitochondrial membrane homeostasis and cellular responses to metabolic stress.

What are the future research directions for Lclat1 studies?

Several promising research directions for Lclat1 warrant further investigation:

  • Generation of knockout models: As noted in the literature, "the in vivo function of this enzyme awaits for the generation and phenotypic characterization of mice with targeted deletion of the ALCAT1 gene" . Such models would provide definitive insights into the physiological roles of Lclat1.

  • Role in specific disease models: Investigating Lclat1 function in models of diseases characterized by mitochondrial dysfunction and oxidative stress could reveal therapeutic potential.

  • Structure-function relationships: Further elucidation of the structural features of Lclat1 that determine its substrate specificity and activity regulation would advance understanding of acyltransferase mechanisms.

  • Interaction with other remodeling enzymes: Studying how Lclat1 works in concert with other enzymes involved in phospholipid remodeling would provide a more complete picture of membrane lipid homeostasis.

  • Regulation beyond thyroid hormone: Exploring additional regulatory mechanisms affecting Lclat1 expression and activity could reveal new insights into how cells adapt their membrane composition to various physiological and pathological conditions.

These research directions hold promise for advancing our understanding of phospholipid metabolism and potentially identifying new therapeutic approaches for diseases involving mitochondrial dysfunction.

What are common challenges in measuring Lclat1 activity and how can they be addressed?

When assessing Lclat1 activity, researchers should be aware of several potential challenges and their solutions:

  • Interference from ATP/ADP: Since ATP and ADP potently inhibit ALCAT1 activity, careful consideration of buffer composition is essential. When studying kinetic properties, researchers should ensure consistent nucleotide concentrations or use nucleotide-free conditions .

  • Distinguishing from mitochondrial MLCL AT: Lclat1 differs from the previously described mitochondrial MLCL AT in several properties, including pH preference and detergent sensitivity. To specifically measure Lclat1 activity, researchers can use basic pH conditions and the presence of detergents, which stimulate Lclat1 but inhibit mitochondrial MLCL AT .

  • Substrate availability: The specialized phospholipid substrates required for Lclat1 assays may not be commercially available in all forms. Researchers may need to synthesize or isolate these substrates, particularly for specialized studies of substrate specificity .

  • Expression system selection: Different expression systems may yield varying levels of active enzyme. When activity is low, optimization of expression conditions or selection of alternative expression systems may be necessary .

By anticipating and addressing these challenges, researchers can develop robust assays for Lclat1 activity that yield reliable and reproducible results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.