Recombinant Mouse Lysophosphatidic acid receptor 1 (Lpar1)

Shipped with Ice Packs
In Stock

Description

Production Systems and Purification

Recombinant mouse Lpar1 is produced using multiple expression platforms:

Expression Systems

Host SystemPurityApplicationsSource
E. coli≥85%Structural studies, antibody production MyBioSource, Antibodies-Online
Baculovirus≥85%Functional assays, ligand screening MyBioSource
Mammalian cells≥85%Cell signaling studies, drug discovery Antibodies-Online

Notable Variants

  • Partial constructs (AA 1-364) retain ligand-binding capacity

  • Strep-tagged versions enable affinity purification

Cellular Signaling Studies

  • Mediates LPA-induced ERK/MAPK activation and Rho GTPase signaling

  • Regulates Schwann cell survival via PI3K/Akt pathways

  • Modulates oligodendrocyte differentiation in CNS development

Disease Models

  • Cancer: Promotes tumor cell invasion and metastasis in neuroblastoma and cervical cancer models

  • Vascular Remodeling:

    • Knockout (Lpar1⁻/⁻) mice exhibit enhanced neointimal hyperplasia

    • Double knockout (Lpar1⁻/⁻; Lpar2⁻/⁻) shows reduced vascular smooth muscle cell migration

Key Findings from Knock-In Models

Lpar1-EGFP Fusion Mice

  • Normal Mendelian transmission with no perinatal lethality

  • EGFP fluorescence correlates with endogenous Lpar1 expression in:

    • Developing CNS (neuroepithelium, marginal zone)

    • Adult hippocampal neurogenesis sites

  • Enables live-cell receptor tracking in disease models

Phenotypic Observations

ModelPhenotypeMechanism
Lpar1⁻/⁻Craniofacial dysmorphism, reduced cortical sizeImpaired NPC proliferation
maLPA1 variantBehavioral deficits (fear extinction)Altered hippocampal neurogenesis

Pharmacological Relevance

  • Agonists: CpY (30x more potent than LPA) stabilizes active receptor conformation via W271⁶·⁴⁸

  • Antagonists: Ki16425 inhibits LPA₁-driven tumor invasion

  • Therapeutic Targets: Obesity, depression, and fibrosis

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on your purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage condition, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Lpar1; Edg2; Gpcr26; Lpa1; Vzg1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2; Rec1.3; VZG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND HSVV
Uniprot No.

Target Background

Function
Lysophosphatidic acid receptor 1 (LPAR1) is a receptor for lysophosphatidic acid (LPA). It plays a crucial role in regulating various cellular processes, including actin cytoskeleton reorganization, cell migration, differentiation, and proliferation. These functions contribute to the body's response to tissue damage and infectious agents. LPAR1 activates downstream signaling pathways via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Signaling inhibits adenylyl cyclase activity, reducing cellular cAMP levels. It also triggers an increase in cytoplasmic Ca(2+) levels. LPAR1 activates RALA, leading to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate. Signaling mediates activation of downstream MAP kinases. LPAR1 contributes to the regulation of cell shape, promoting Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction. It promotes the activation of Rho and the formation of actin stress fibers. LPAR1 also promotes the formation of lamellipodia at the leading edge of migrating cells via activation of RAC1. Through its function as a lysophosphatidic acid receptor, it plays a role in chemotaxis and cell migration, including responses to injury and wounding. LPAR1 triggers inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14. It promotes cell proliferation in response to lysophosphatidic acid. LPAR1 is essential for normal skeleton development and may play a role in osteoblast differentiation. It is also required for normal brain development, particularly for the proliferation, survival, and maturation of newly formed neurons in the adult dentate gyrus. LPAR1 plays a role in pain perception and the initiation of neuropathic pain.
Gene References Into Functions
  1. Research indicates that lysophosphatidic acid (LPA) promotes post-injury Schwann cell (SC) dedifferentiation through LPA1 signaling. These findings suggest that LPA may be a critical factor contributing to the shift of SCs towards a post-injury phenotype and the onset of Wallerian degeneration. PMID: 29051083
  2. Studies have shown that LPA1/3 antagonism mildly reduced plasma LDL cholesterol levels. This suggests that pharmacological inhibition of LPA1/3 receptors could be a promising strategy to mitigate atherosclerosis development. PMID: 27883026
  3. LPA receptor 1 signaling has been found to increase TGFbeta expression via GSK3beta phosphorylation and SREBP1 activation, contributing to the development of diabetic nephropathy. PMID: 28111010
  4. Data suggest that LPAR signaling stimulates SS development by inducing IL-17 production through ROCK and p38 MAPK pathways. Therefore, inhibiting LPAR could be a potential therapeutic approach for SS. PMID: 28460477
  5. Research findings indicate that LPA-enhanced foam cell formation is mediated by LPA1/3 -AKT activation and subsequent SRBI expression. PMID: 28765047
  6. Lysophosphatidic acid-LPA1 signaling is critical for septation during alveolarization. PMID: 27082727
  7. Data show that lysophosphatidic acid receptor 1 (LPA1)-green fluorescent proteins can be used to directly quantify the running-induced increase in precursor proliferation. PMID: 27050949
  8. Results indicate a significant role for the Lysophosphatidic acid/Lysophosphatidic acid receptor 1 signaling system in alcoholism. Furthermore, LPA1-null mice emerge as a model for genetic susceptibility to excessive alcohol consumption. PMID: 26700247
  9. Findings reveal a functional role for the lysophosphatidic acid 1 receptor in regulating oligodendrocyte differentiation and myelination within the central nervous system. PMID: 25226845
  10. Data demonstrate that lysophosphatidic acid (LPA) induces phosphorylation of the trkA receptor (TrkA) through LPA1 binding to TrkA. PMID: 26597701
  11. The LPA receptor plays a role in bone loss in ovariectomized mice, but the beneficial effect of its inhibition on bone remodeling appears to be less general than initially hypothesized. PMID: 24994065
  12. These findings suggest that tumor and stromal LPA receptors, particularly LPA1 and LPA5, play distinct roles in invasion and the seeding of metastasis. PMID: 25158955
  13. The LPA1 receptor is involved in emotional behaviors and the anatomical integrity of the corticolimbic circuit, whose dysregulation may be a predisposing factor for anxiety disorders. PMID: 23775489
  14. These results indicate that Ile325, Tyr85, and Leu87 within LPA1 are crucial for proper folding of the LPA1 protein in the ER. PMID: 25025571
  15. Research suggests that LPA1 receptor-mediated amplification of spinal LPA production is necessary for the development of paclitaxel-induced neuropathic pain. PMID: 25411045
  16. These findings demonstrate that LPA1 is essential for in vitro and in vivo osteoclast activities. PMID: 24429286
  17. Ultrastructural analyses of peripheral nerves in mouse null-mutants for LPA1 revealed delayed Schwann cell-to-axon segregation, polyaxonal myelination by single Schwann cells, and thinner myelin sheaths. PMID: 24115248
  18. This study demonstrates a correlation between gene expression and cell birthdates. Lpar1 cells are preferentially generated on E11.5 and exhibit enhanced survival after the first postnatal week compared to other subplate neurons. PMID: 22628460
  19. Lysophosphatidic acid receptor 1 is crucial for the development of arthritis. PMID: 23666827
  20. LPA1 receptor signaling plays pivotal roles in the development of central neuropathic pain following cerebral ischemia. PMID: 23318243
  21. Galphaq-coupled Lpar1 regulates cell proliferation and migration by activating two distinct PLC-beta isozymes, PLC-beta1 and PLC-beta2, respectively. PMID: 23478264
  22. LPA(1) is involved in bone development by promoting osteogenesis. PMID: 22867754
  23. LPA(1)-null mice exhibited basal c-Fos hyperactivity in the hippocampus and the medial prefrontal cortex, which was regulated differently by the two distinct memory tasks employed. PMID: 22537775
  24. Findings suggest that the LPA1 receptor may be essential for normal associative contextual learning associated with cocaine, likely through the modulation of hippocampal glutamatergic circuits. PMID: 21887497
  25. The ability of LPA-LPA(1) signaling to promote epithelial cell apoptosis and fibroblast resistance to apoptosis may contribute to the regulation of pulmonary fibrosis development following lung injury. PMID: 22021336
  26. The ATX-LPA-LPAR axis is a critical regulator of embryonic vascular development that is conserved across vertebrates. PMID: 21971049
  27. These results indicate that LPA1 strongly influences bone development both qualitatively and quantitatively. Its absence in vivo leads to decreased osteogenesis without significant changes in osteoclasis. PMID: 21569876
  28. The absence of the LPA receptor exacerbates the impairment of hippocampal neurogenesis and its dependent functions induced by chronic stress. PMID: 21980482
  29. Lysophosphatidic acid receptor 1 modulates lipopolysaccharide-induced inflammation in alveolar epithelial cells and murine lungs. PMID: 21821728
  30. These findings suggest defined pathways for signaling through the lysophosphatidic acid receptor 1 to promote lysophosphatidic acid-mediated myosin II activation and subsequent cell migration in 4T1 breast cancer cells. PMID: 21302283
  31. This study demonstrates that CaMKII and related synaptic mechanisms at glutamatergic synapses are significantly dysregulated in LPA1 KO mice. PMID: 20942999
  32. These data identify stereotyped and selective hypoxia-induced cerebral cortical disruption requiring LPA(1) signaling. PMID: 21878565
  33. LPA1 receptor plays a role in angiogenesis in tumor cells and xenografts. PMID: 20708100
  34. These results indicate that lysophosphatidic acid, converted from lysophosphatidylcholine by ATX, activates LPA1 receptors and induces dorsal root demyelination following nerve injury, leading to neuropathic pain. PMID: 21062487
  35. LPA(1-3) are differentially expressed in the central nervous system and their expression is upregulated in response to injury. PMID: 20495828
  36. Exploratory and emotional impairments did not account for the cognitive deficits that may be attributed to maLPA(1) nulls' hippocampal malfunction. PMID: 20388543
  37. LPA(1) and LPA(3) (lysophosphatidic acid)receptors promote neointima formation through activation of CXCL12-mediated mobilization and recruitment of smooth muscle progenitor cells. PMID: 20360252
  38. Lysophosphatidic acid receptor-1 has a role in diet-induced obesity. PMID: 20358347
  39. We propose that the LPA(1) receptor may play a major role in both spatial memory and response to anxiety-like conditions. PMID: 19689455
  40. LPA stimulation promotes the interaction of the LPA(2) receptor with a focal adhesion molecule, TRIP6. PMID: 14688263
  41. A marked deficit in prepulse inhibition, alterations in brain 5-HT levels, and craniofacial dysmorphism are observed in LPA1 receptor-deficient mice, defects resembling those found in psychiatric disease. PMID: 14697676
  42. LPA and angiotensin II were also capable of inducing LPA1 receptor phosphorylation, demonstrating that the LPA1 receptor can undergo both homologous and heterologous desensitization. PMID: 15369458
  43. LPA does not act as a potent PPARgamma agonist in adipocytes but, conversely, inhibits PPARgamma expression and adipogenesis via LPA(1) receptor activation. PMID: 15710620
  44. LPA(1) plays a role in normal cortical development and suggests that genetic modifiers of LPA(1) influence cerebral cortical development. PMID: 17656621
  45. LPA1 links pulmonary fibrosis to lung injury by mediating fibroblast recruitment and vascular leak. PMID: 18066075
  46. Distinct molecular mechanisms regulate agonist-dependent and PMA-dependent internalization of the LPA 1 receptor. PMID: 18089565
  47. The results demonstrated that in C9 cells, estrogens modulate LPA(1) action through estrogen receptor alpha with the involvement of protein kinase C alpha and phosphoinositide 3-kinase. PMID: 18166159
  48. A novel in vivo function for LPA signaling as a germ cell survival factor during spermatogenesis. PMID: 18448840
  49. Results support the operation of lysophosphatidic acid receptor (1) signaling pathways in the normal proliferation, maturation, and differentiation of neuronal precursors. PMID: 18708146
  50. A direct role for LPA receptor signaling in cell transformation and tumorigenesis in conjunction with c-Myc. PMID: 18762810

Show More

Hide All

Database Links

KEGG: mmu:14745

STRING: 10090.ENSMUSP00000052581

UniGene: Mm.4772

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell surface. Cell membrane; Multi-pass membrane protein. Endosome.
Tissue Specificity
Detected in lung. Detected in oligodendrocytes in corpus callosum in brain cortex (at protein level). Expressed within the embryonic cerebral cortex, where it is enriched in the ventricular zone. In the adult brain, also expressed in oligodendrocytes, as

Q&A

What is Lysophosphatidic Acid Receptor 1 (Lpar1) and what is its significance in mouse models?

Lysophosphatidic Acid Receptor 1 (Lpar1) is a G protein-coupled receptor (GPCR) that belongs to the endothelial differentiation gene (EDG) family along with LPA2-3 and sphingosine-1-phosphate receptors (S1P1-5). It is activated by the lipid mediator lysophosphatidic acid (LPA), which functions as an intercellular signaling molecule. The receptor plays crucial roles in multiple physiological and pathological processes, including fibrosis, inflammation, cell migration, and differentiation. In mouse models, Lpar1 has been extensively studied to understand its involvement in various conditions including cardiac hypertrophy, vascular injury responses, and oligodendrocyte development. The recombinant form is particularly valuable for in vitro binding studies, structural analyses, and pharmacological screening of potential therapeutic compounds .

How does Lpar1 expression vary across different cell types in mouse tissues?

Lpar1 demonstrates distinct expression patterns across various mouse tissues and cell types. Single-nucleus RNA sequencing of left ventricular tissue has shown that Lpar1 is predominantly expressed by lymphatic endothelial cells (LECs) and cardiac fibroblasts. This has been confirmed through immunofluorescence staining of LEC markers like Lyve1 and Ccl21a, as well as through in situ hybridization for Reln and Ccl21a .

In the central nervous system, Lpar1 is expressed in oligodendrocyte precursor cells (OPCs), with expression levels actually increasing as OPCs differentiate into mature oligodendrocytes. This pattern has been validated through quantitative PCR analysis of O4+ OPCs isolated from rat cortex, which also demonstrated that Lpar2-5 mRNA expression was significantly lower in these cells compared to Lpar1. During the differentiation process triggered by platelet-derived growth factor (PDGF) withdrawal, an increase in Lpar1 expression coincides with an increase in the oligodendrocyte marker myelin basic protein (Mbp) and a decrease in the OPC marker Pdgfra .

In vascular tissues, Lpar1 is expressed in smooth muscle cells (SMCs) where it contributes to migration responses following vascular injury .

What are the primary signaling pathways activated by Lpar1 in mouse models?

Lpar1 activates multiple downstream signaling pathways that mediate its diverse biological effects:

Signaling PathwayCellular ResponseExperimental Evidence
G protein-coupled pathwaysCell migration, proliferationG protein-biased agonists like OMPT activate these pathways preferentially
Rho signalingCytoskeletal reorganization, cell migrationIdentified as one of the top canonical pathways activated by OMPT via Lpar1
MAPK pathwayCell proliferation, differentiationPathway analysis reveals MAPK as a key downstream signal of Lpar1
β-arrestin pathwayReceptor internalization, desensitizationLPA induces Lpar1 endocytosis in a β-arrestin-dependent manner
Extracellular signal-regulated protein kinase (ERK)Growth and proliferationERK activation is attenuated in SMCs isolated from Lpar1-deficient mice

Importantly, these pathways can be selectively activated by different ligands. For instance, research has demonstrated that while the endogenous ligand LPA activates both G protein and β-arrestin pathways, certain compounds like OMPT and tricyclic antidepressants exhibit G protein-biased agonism, activating G protein-mediated signaling without substantial β-arrestin recruitment .

What are the recommended methods for measuring Lpar1 binding kinetics and affinity in recombinant systems?

Assessing Lpar1 binding kinetics and affinity requires precise methodology. A recommended approach is the forward kinetic method, which has been successfully applied to characterize binding properties of compounds like PIPE-791 to human LPA1 receptor. This method involves mixing the compound of interest (e.g., 1 μM) with varying concentrations (0.25, 0.5, or 1 nM) of a radiolabeled version of the same compound. Binding is initiated by adding Lpar1 overexpressing membranes at different time points (ranging from 1 minute to 24 hours), followed by filtration to separate bound from unbound ligand .

For affinity measurements, saturation binding experiments can be performed in both recombinant systems and native tissue settings such as mouse and human brain homogenates. These experiments typically use increasing concentrations of a radiolabeled ligand to determine binding parameters like Kd (dissociation constant) and Bmax (maximum binding capacity) .

Competition binding assays are also valuable for determining the affinity of unlabeled compounds, by measuring their ability to displace a fixed concentration of a known labeled ligand. This approach allows for comparison of relative affinities across different compounds and can help identify selective ligands for Lpar1 over other LPA receptors .

The choice of expression system is crucial, with HEK293 cells being commonly used for recombinant Lpar1 expression due to their robust protein expression capabilities and low endogenous LPA receptor levels .

How can researchers effectively analyze Lpar1 expression changes in mouse models using quantitative techniques?

Several quantitative approaches can be employed to accurately measure Lpar1 expression changes:

  • Quantitative PCR (qPCR): This technique allows precise measurement of Lpar1 mRNA levels. When analyzing OPCs, for example, cells can be isolated using OPC-specific surface markers like O4, followed by qPCR analysis of Lpar1-5 expression. This method has successfully demonstrated that Lpar1 is the predominant LPA receptor in OPCs .

  • Single-nucleus RNA sequencing: This powerful approach provides comprehensive transcriptomic profiling at the single-cell level. It has been used to demonstrate that Lpar1 is predominantly expressed by lymphatic endothelial cells and cardiac fibroblasts in the left ventricular tissue .

  • In situ hybridization: This technique allows visualization of Lpar1 mRNA within intact tissue sections, preserving spatial information. It has been successfully used to detect Lpar1 expression markers like Reln and Ccl21a .

  • Immunofluorescence staining: For protein-level detection, immunofluorescence staining with specific antibodies against Lpar1 or cell-type markers that correlate with Lpar1 expression (such as Lyve1 and Ccl21a for lymphatic endothelial cells) provides spatial information about expression patterns .

  • Flow cytometry: This technique can be used to quantify Lpar1 protein levels on the cell surface, particularly when studying receptor internalization or trafficking. For example, researchers have used flow cytometry to demonstrate that LPA induces β-arrestin-dependent Lpar1 endocytosis while certain agonists like OMPT do not .

When analyzing expression changes over time or in response to treatments, it's crucial to include appropriate housekeeping genes or normalization controls and to perform experiments in biological replicates to ensure statistical validity.

What cellular and animal models are most appropriate for studying Lpar1 function in neurological and cardiovascular systems?

Several cellular and animal models have proven effective for investigating Lpar1 function:

Cellular Models:

  • Primary OPCs: Isolated using OPC-specific markers like O4, these cells are valuable for studying Lpar1's role in myelination. PDGF withdrawal paradigms can be used to induce differentiation, allowing assessment of how Lpar1 signaling affects this process .

  • HEK293 cells with recombinant Lpar1 expression: These provide a clean system for studying receptor pharmacology, binding properties, and signaling. Both wildtype HEK293 cells and those lacking β-arrestin1/2 can be used to dissect signaling pathway selectivity .

  • Primary cardiac fibroblasts and lymphatic endothelial cells: Given Lpar1's expression in these cell types, they are relevant for cardiovascular studies .

  • Vascular smooth muscle cells (SMCs): Isolated SMCs have been used to study Lpar1's role in migration and phenotypic modulation following vascular injury .

Animal Models:

  • Lpar1 knockout mice: These mice (Lpar1-/-) have been extensively used to study the receptor's function in various physiological and pathological contexts .

  • Disease-specific models with Lpar1 knockout: Breeding Lpar1-/- mice with disease models, such as mice carrying pathogenic myosin heavy-chain variants (403+/-) that develop hypertrophic cardiomyopathy, allows investigation of Lpar1's role in disease progression .

  • Vascular injury models: Wire-induced carotid artery injury in mice with Lpar1 deficiency helps elucidate the receptor's role in vascular remodeling and neointimal hyperplasia .

  • Multiple sclerosis models: Given Lpar1's expression in OPCs and its potential role in myelination, models of demyelinating diseases can be valuable for studying Lpar1 in neurological contexts .

  • Depression models: Since tricyclic antidepressants have been identified as G protein-biased Lpar1 agonists, models of depression can be used to explore Lpar1's potential role in mood disorders .

When selecting a model, researchers should consider the specific aspect of Lpar1 biology they wish to study, the readouts available in each model, and how closely the model recapitulates human disease pathophysiology.

How does genetic ablation of Lpar1 affect hypertrophic cardiomyopathy progression in mouse models?

Genetic ablation of Lpar1 has significant protective effects against hypertrophic cardiomyopathy (HCM) progression in mouse models. HCM is the most common inherited cardiomyopathy, characterized by myocardial fibrosis that increases patients' risk of arrhythmias, heart failure, and stroke. Studies using mice carrying a pathogenic myosin heavy-chain variant (403+/-) that develop HCM have provided valuable insights into Lpar1's role in this disease .

When HCM mice (403+/-) were bred with Lpar1-ablated mice to create mice carrying both genetic changes (403+/-LPAR1-/-), these animals developed significantly less hypertrophy and fibrosis compared to 403+/-LPAR1 WT mice. This indicates that Lpar1 signaling is required for the full development of the HCM phenotype .

The mechanism underlying this protection appears to involve multiple cell types and processes. Single-nucleus RNA sequencing of left ventricular tissue demonstrated that Lpar1 is predominantly expressed by lymphatic endothelial cells (LECs) and cardiac fibroblasts. Lpar1 ablation reduced the population of LECs, which was confirmed by immunofluorescence staining of LEC markers Lyve1 and Ccl21a and by in situ hybridization for Reln and Ccl21a. Additionally, Lpar1 ablation altered the distribution of fibroblast subtypes, suggesting that both LECs and fibroblasts contribute to HCM pathogenesis through Lpar1-dependent mechanisms .

These findings indicate that targeting Lpar1 could be a promising therapeutic strategy for HCM, particularly since the presence of fibrosis is associated with adverse outcomes in this disease .

What is the role of Lpar1 in multiple sclerosis and other neuroinflammatory conditions based on recent mouse model studies?

Recent mouse model studies have revealed important roles for Lpar1 in multiple sclerosis (MS) and other neuroinflammatory conditions. MS is characterized by inflammation, demyelination, and neurodegeneration, with oligodendrocyte precursor cells (OPCs) playing a crucial role in remyelination. Since Lpar1 is expressed in OPCs, its signaling affects processes relevant to MS pathophysiology .

Research has confirmed that Lpar1 is expressed in OPCs isolated using the OPC-specific surface marker O4, with expression actually increasing as OPCs differentiate into oligodendrocytes. This was demonstrated by examining Lpar1 expression during OPC differentiation induced by platelet-derived growth factor (PDGF) withdrawal. As differentiation progressed, researchers observed an increase in the oligodendrocyte marker myelin basic protein (Mbp), a decrease in the OPC marker Pdgfra, and an increase in Lpar1 expression .

Functionally, exogenous application of LPA to OPCs during differentiation resulted in a dose-dependent inhibition of OPC differentiation, suggesting that LPA receptor activation negatively regulates this process. Supporting this, cultured OPCs from Lpar1 knockout mice show enhanced differentiation compared to wildtype controls, indicating that Lpar1 signaling normally restrains OPC differentiation .

Beyond effects on OPC differentiation, Lpar1 blockade has been shown to alleviate inflammation and fibrosis, both of which are contributing factors to MS. The development of brain-penetrant Lpar1 antagonists like PIPE-791, which exhibits slow binding kinetics with a calculated t1/2 of 8.65 hours, provides tools to further investigate Lpar1's role in MS and potential therapeutic applications .

These findings collectively suggest that Lpar1 antagonism could promote remyelination in MS by enhancing OPC differentiation while simultaneously reducing inflammation and fibrosis—a multi-faceted approach that addresses several key aspects of MS pathophysiology.

How does Lpar1 contribute to vascular injury responses and what are the implications for cardiovascular disease research?

Lpar1 plays a complex role in vascular injury responses with important implications for cardiovascular disease research. Studies using mouse models of vascular injury have elucidated the contribution of Lpar1 and other LPA receptors to the development of neointimal hyperplasia, a key process in various cardiovascular pathologies .

Interestingly, Lpar1 appears to have a protective effect against neointimal hyperplasia, as Lpar1-/- mice developed larger neointimal lesions after injury compared to wild-type controls. This contrasts with mice deficient in both Lpar1 and Lpar2 (Lpar1-/-Lpar2-/- mice), which were partially protected from developing injury-induced neointimal hyperplasia. This suggests that Lpar1 and Lpar2 have distinct and sometimes opposing roles in vascular injury responses .

At the cellular level, smooth muscle cells (SMCs) isolated from Lpar1-/-Lpar2-/- mice showed attenuated responses to growth factors in serum, LPA-induced extracellular signal-regulated protein kinase activation, and migration to LPA and serum. In contrast, Lpar1-/- SMCs exhibited enhanced migration, which was attributed to an upregulation of Lpar3, suggesting compensatory mechanisms when Lpar1 is absent .

Despite the involvement of Lpar1 in intimal hyperplasia, neither Lpar1 nor Lpar2 was required for the dedifferentiation of SMCs following vascular injury or for LPA-induced dedifferentiation of isolated SMCs in vitro. Similarly, neither receptor was necessary for LPA to elicit a transient increase in blood pressure following intravenous administration .

These findings highlight the complex and sometimes contradictory roles of different LPA receptors in vascular pathophysiology, emphasizing the need for receptor-specific approaches in cardiovascular disease research. The understanding that Lpar1 may actually protect against neointimal hyperplasia while Lpar3 promotes it (as suggested by the upregulation of Lpar3 in Lpar1-/- SMCs) has important implications for drug development, suggesting that selective targeting of specific LPA receptor subtypes rather than broad LPA inhibition might be necessary for optimal therapeutic outcomes.

What are the key structural features of Lpar1 that determine ligand selectivity and activation mechanisms?

Recent cryo-electron microscopy studies have revealed crucial structural features of Lpar1 that govern ligand selectivity and activation mechanisms. A notable investigation examined the structure of the human LPA1-Gi complex bound to a nonlipid basic agonist called CpY, which demonstrates 30-fold higher agonistic activity compared to the endogenous ligand LPA .

The binding pocket of Lpar1 possesses distinctive characteristics that enable selective recognition of different ligands. A key feature is the presence of a negative charge in the characteristic binding pocket of Lpar1, which allows for the selective recognition of CpY despite its lack of a polar head group. This electrostatic complementarity is crucial for ligand selectivity and helps explain why certain nonlipid molecules can effectively activate Lpar1 .

The activation mechanism of Lpar1 has been elucidated through structural analyses revealing key molecular interactions. For CpY, a critical interaction involves its ethyl group directly pushing against the W271^6.48 residue, which stabilizes the active conformation of the receptor. This direct interaction represents a significant mechanism by which nonlipid agonists can potently activate Lpar1. Interestingly, endogenous LPA lacks these specific chemical features, explaining the enhanced potency of certain synthetic ligands .

Comparative structural analysis of Lpar1 with other lipid GPCRs provides additional insights into the basis for ligand selectivity. The unique arrangement of the transmembrane domains and extracellular loops creates a binding environment that distinguishes Lpar1 from related receptors like S1P receptors, despite their sequence similarity within the EDG family .

These structural insights are invaluable for rational drug design targeting Lpar1, as they allow for the development of compounds with enhanced selectivity and potency by exploiting specific interactions within the binding pocket.

How do biased agonists of Lpar1 differ from traditional agonists in their signaling and physiological effects?

Biased agonists of Lpar1 represent an important class of ligands that selectively activate certain signaling pathways while minimizing others, resulting in distinct physiological outcomes. Research has revealed significant differences between biased and traditional agonists in both their molecular mechanisms and downstream effects .

Traditional agonists like LPA typically activate multiple downstream pathways, including both G protein-mediated signaling and β-arrestin recruitment. In contrast, G protein-biased agonists such as OMPT (1-oleoyl-2-O-methyl-sn-glycero-3-phosphothionate) and certain tricyclic antidepressants (TCAs) selectively activate G protein signaling with minimal β-arrestin engagement .

The molecular evidence for this bias is compelling. Unlike LPA, which decreases cell surface expression of Lpar1 in HEK293 cells through β-arrestin-dependent endocytosis, OMPT and amitriptyline (a TCA) do not induce β-arrestin-dependent receptor internalization. This difference in receptor trafficking has important implications for signaling duration and desensitization .

The physiological consequences of biased agonism extend to gene expression patterns. Rank-rank hypergeometric overlap analysis revealed substantial differences in gene regulation between LPA and OMPT. Ingenuity pathway analysis of differentially regulated genes showed that four of the top five canonical pathways predicted to be activated by OMPT were associated with downstream signals of Lpar1 (Rho and MAPK pathways). In contrast, pathways predicted to be activated by LPA were negatively regulated by Lpar1, suggesting that long-term exposure to these different ligands results in fundamentally different cellular responses .

In the context of depression models, the transcription pattern induced by OMPT showed a concordant overlap with patterns observed in resilient mice and mice treated with the antidepressant imipramine. This suggests that G protein-biased Lpar1 agonism may contribute to resilience against depression, potentially explaining the mechanism of action for certain antidepressants .

These differences highlight the potential of biased Lpar1 agonists as therapeutic agents with improved efficacy and reduced side effects compared to traditional non-selective agonists. By selectively activating beneficial signaling pathways while avoiding those associated with adverse effects, biased ligands offer a more targeted approach to Lpar1 modulation.

What advanced techniques are being used to develop selective Lpar1 modulators for potential therapeutic applications?

The development of selective Lpar1 modulators for therapeutic applications involves a sophisticated array of advanced techniques spanning structural biology, medicinal chemistry, and translational research. Several cutting-edge approaches are being employed to create compounds with optimal selectivity, potency, and pharmacokinetic properties .

Structure-Guided Drug Design:
Cryo-electron microscopy (cryo-EM) has revolutionized our understanding of Lpar1 structure and ligand interactions. By resolving the structure of the human LPA1-Gi complex bound to nonlipid agonists like CpY, researchers have identified key binding pocket features and activation mechanisms. This structural information enables rational design of compounds that exploit specific interactions, such as the ethyl group of CpY pushing against W271^6.48 to stabilize the active conformation .

Binding Kinetics Optimization:
Beyond traditional affinity measurements, researchers are now focusing on binding kinetics to develop compounds with optimal residence times. For example, PIPE-791, a brain-penetrant Lpar1 antagonist, exhibits slow binding kinetics with a calculated t1/2 of 8.65 hours. This extended target engagement may contribute to sustained efficacy in vivo. Specialized radioligand binding assays using forward kinetic methods have been developed to characterize these properties .

Drug Delivery Innovations:
Novel delivery systems are being explored to enhance the therapeutic potential of Lpar1 modulators. One innovative approach involves the integration of Lpar1 antagonists (AM095 or Ki16425) into liposomal formulations. By embedding these compounds within the lipid bilayer of liposomes, researchers have created targeted delivery systems with enhanced bioavailability. The efficacy of these liposomal antagonists (L-aLPAR1) has been evaluated both in vitro and in vivo, demonstrating improved cellular internalization and tumor accumulation in mouse models .

In vivo pharmacokinetic and biodistribution studies:
Advanced imaging techniques such as IVIS Lumina II imaging systems are being used to track the biodistribution of Lpar1-targeted therapeutics in live animals. This allows researchers to measure tumor accumulation at multiple timepoints (1.5, 3, 6, 9, 24, and 48 hours post-injection) and perform ex vivo organ analyses to comprehensively assess tissue distribution .

Transcriptomic Profiling:
To understand the broader effects of Lpar1 modulators, researchers are utilizing sophisticated transcriptomic approaches. Threshold-free rank-rank hypergeometric overlap (RRHO) analysis and Ingenuity pathway analysis are being employed to characterize differential gene expression patterns induced by various Lpar1 ligands. These analyses help identify the molecular signatures associated with therapeutic efficacy versus adverse effects, guiding the selection of compounds with optimal activity profiles .

These advanced techniques collectively represent a multidisciplinary approach to Lpar1 modulator development, integrating structural insights, medicinal chemistry, pharmacokinetics, and systems biology to create next-generation therapeutics for conditions ranging from fibrotic disorders to neurological diseases.

What are the common pitfalls in Lpar1 knockout/knockdown studies and how can they be addressed?

Lpar1 knockout and knockdown studies present several challenges that can affect experimental outcomes and interpretations. Recognizing and addressing these pitfalls is essential for generating reliable and reproducible results:

Compensatory Upregulation of Other LPA Receptors:
One of the most significant challenges in Lpar1 knockout studies is the compensatory upregulation of other LPA receptor subtypes. For instance, smooth muscle cells isolated from Lpar1-/- mice exhibit enhanced migration due to upregulation of Lpar3, potentially masking the true function of Lpar1 . To address this issue:

  • Include comprehensive expression analysis of all LPA receptor subtypes in knockout models

  • Consider using combinatorial knockout approaches (e.g., Lpar1-/-Lpar2-/- double knockouts)

  • Use acute knockdown methods like siRNA or inducible knockout systems to minimize compensatory adaptations

  • Validate findings with selective pharmacological tools in addition to genetic approaches

Developmental Versus Acute Effects:
Global Lpar1 knockout can cause developmental abnormalities that complicate the interpretation of phenotypes in adult mice. For example, Lpar1 plays roles in neural development, and knockout mice may have altered neuroanatomy that confounds behavioral or physiological studies. Strategies to overcome this include:

  • Using conditional knockout systems (e.g., Cre-loxP) to delete Lpar1 in specific tissues or at specific times

  • Complementing knockout studies with acute pharmacological inhibition

  • Performing rescue experiments by reintroducing Lpar1 in knockout backgrounds

Cell Type-Specific Expression and Function:
Given that Lpar1 is expressed in multiple cell types including lymphatic endothelial cells, fibroblasts, oligodendrocyte precursor cells, and smooth muscle cells, global knockout may affect multiple systems simultaneously . This complexity can be addressed by:

  • Using cell type-specific knockout models to isolate the contribution of Lpar1 in individual cell populations

  • Performing comprehensive cell type-specific expression analysis using techniques like single-nucleus RNA sequencing

  • Combining in vivo studies with isolated cell systems to dissect cell-autonomous versus non-cell-autonomous effects

Background Strain Differences:
The genetic background of knockout mice can significantly influence phenotypes. Researchers should:

  • Maintain consistent genetic backgrounds across experimental and control groups

  • Consider backcrossing to multiple strains to confirm that findings are robust across genetic backgrounds

  • Report complete details of the genetic background in publications

Incomplete Lpar1 Deletion:
Inefficient knockout or knockdown can lead to residual Lpar1 activity that complicates interpretation. To mitigate this:

  • Validate knockout efficiency at both mRNA and protein levels

  • Consider using multiple targeting strategies for knockout generation

  • For knockdown studies, optimize transfection conditions and validate knockdown efficiency in each experiment

How can researchers distinguish between direct and indirect effects of Lpar1 modulation in complex biological systems?

Distinguishing between direct and indirect effects of Lpar1 modulation remains one of the most challenging aspects of research in this field. Given Lpar1's expression across multiple cell types and its involvement in various signaling networks, determining causality requires sophisticated experimental approaches:

Temporal Resolution Studies:
Direct effects of Lpar1 modulation typically occur rapidly, while indirect effects develop over longer timeframes. Researchers can leverage this distinction by:

  • Conducting detailed time-course experiments to track the sequence of molecular and cellular events following Lpar1 activation or inhibition

  • Using rapid techniques like calcium imaging or FRET-based sensors to capture immediate signaling events

  • Comparing acute versus chronic effects of Lpar1 modulation to distinguish primary from secondary responses

Pathway Inhibition Approaches:
By selectively blocking potential downstream mediators, researchers can determine which effects require specific signaling pathways:

  • Employ selective inhibitors of key Lpar1 downstream pathways (e.g., Rho kinase inhibitors, MAPK inhibitors) to determine which effects persist when these pathways are blocked

  • Use genetic approaches like dominant-negative constructs or CRISPR interference to selectively inhibit specific downstream effectors

  • Perform epistasis experiments in which Lpar1 is activated or inhibited in the context of downstream pathway blockade

Cell Type-Specific Interventions:
Given Lpar1's expression across multiple cell types, isolating cell-autonomous effects is crucial:

  • Utilize conditional knockout or knockdown systems that target Lpar1 in specific cell populations

  • Perform co-culture experiments with defined cell populations to identify intercellular signaling

  • Use cell type-specific Cre-driver lines for in vivo studies to achieve spatial control of Lpar1 modulation

Pharmacological Validation:
Complementing genetic approaches with pharmacological tools can help validate direct effects:

  • Compare results from genetic deletion with selective Lpar1 antagonists like PIPE-791 or AM095

  • Use structurally distinct antagonists to rule out off-target effects

  • Implement dose-response studies to establish pharmacological relevance

Systems Biology Approaches:
Comprehensive analysis of molecular networks can help distinguish primary from secondary effects:

  • Employ time-resolved transcriptomic or proteomic analysis to identify immediate-early response genes or proteins following Lpar1 modulation

  • Use computational modeling to predict direct targets based on known signaling networks

  • Apply threshold-free rank-rank hypergeometric overlap (RRHO) analysis to identify concordant and discordant gene expression patterns, as demonstrated in studies comparing effects of different Lpar1 ligands

By integrating these approaches, researchers can build a more complete understanding of how Lpar1 modulation directly affects cellular function versus how these primary effects propagate through biological systems to produce secondary and tertiary consequences.

What are the key considerations for translating findings from mouse Lpar1 studies to human therapeutic applications?

Translating findings from mouse Lpar1 studies to human therapeutic applications requires careful consideration of multiple factors that influence the validity and applicability of preclinical results:

Species-Specific Differences in Lpar1 Structure and Pharmacology:
Despite high conservation, mouse and human Lpar1 exhibit differences that may affect drug responses:

  • Conduct comparative binding studies with potential therapeutic compounds against both mouse and human Lpar1

  • Perform sequence and structural alignments to identify critical residues that differ between species

  • Consider using humanized mouse models expressing human Lpar1 for advanced pharmacological studies

  • Validate key findings in both mouse and human cellular systems where possible

Expression Pattern Variations:
Differences in tissue distribution and expression levels between mouse and human Lpar1 may impact therapeutic targeting:

  • Compare Lpar1 expression patterns across species using techniques like single-cell RNA sequencing

  • Focus translational efforts on pathways and tissues where expression patterns are conserved

  • Consider potential off-target effects based on human-specific expression patterns not present in mouse models

Disease Model Relevance:
Not all mouse disease models accurately reflect human pathophysiology:

  • Evaluate how closely mouse models recapitulate key features of human diseases where Lpar1 targeting is proposed

  • Consider using multiple disease models to strengthen translational validity

  • Validate biomarkers of Lpar1 modulation that can be monitored in both preclinical models and human studies

Pharmacokinetic and Pharmacodynamic Considerations:
Drug metabolism and distribution often differ between mice and humans:

  • Develop translational pharmacokinetic/pharmacodynamic (PK/PD) models that account for species differences

  • Establish target engagement biomarkers that can be monitored across species

  • Consider novel drug delivery approaches like liposomal formulations (L-aLPAR1) that may help overcome PK challenges

Biomarker Development for Clinical Translation:
Identifying reliable biomarkers that indicate Lpar1 engagement is crucial for clinical studies:

  • Focus on conserved downstream signals that can be measured in accessible human samples

  • Develop imaging approaches for monitoring target engagement in vivo

  • Identify gene expression signatures associated with successful Lpar1 modulation that could serve as pharmacodynamic markers

Safety Considerations:
The wide expression of Lpar1 across tissues raises safety concerns:

  • Thoroughly characterize phenotypes of Lpar1 knockout mice to anticipate potential adverse effects

  • Consider the development of tissue-selective modulators or delivery systems to minimize off-target effects

  • Evaluate effects of Lpar1 modulation on cardiovascular parameters, given its role in blood pressure regulation and vascular responses

Dosing and Timing Strategies:
Optimizing when and how to modulate Lpar1 is critical for therapeutic success:

  • Consider the temporal dynamics of disease processes and identify optimal intervention windows

  • Evaluate both continuous and intermittent dosing approaches to minimize potential desensitization

  • Explore combinatorial approaches that target Lpar1 alongside complementary pathways

By systematically addressing these considerations, researchers can enhance the translational validity of their mouse Lpar1 studies and develop more effective human therapeutic strategies targeting this important receptor system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.