Recombinant Mouse Lysophosphatidylcholine acyltransferase 2B (Lpcat2b)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse Lysophosphatidylcholine Acyltransferase 2B (Lpcat2b) is a recombinant protein of the enzyme Lysophosphatidylcholine acyltransferase 2B, which is found in Mus musculus (Mouse) . Lysophosphatidylcholine acyltransferases (LPCATs) are a class of enzymes that play a crucial role in phospholipid metabolism by catalyzing the reacylation of lysophospholipids to produce phosphatidylcholines (PCs) . Specifically, LPCAT2 is involved in the inflammatory response and the production of lipid droplets in cells .

General Information

CharacteristicDescription
NameLysophosphatidylcholine acyltransferase 2B
SynonymsAytl1b, Acyltransferase-like 1-B
SpeciesMus musculus (Mouse)
Uniprot NO.Q9D5U0
EC Number2.3.1.-
Molecular WeightUnavailable
AA Sequence Length516
Tag InformationDetermined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
Storage ConditionsStore at -20℃, for extended storage, conserve at -20℃ or -80℃; avoid repeated freezing and thawing; store working aliquots at 4℃ for up to one week
Amino Acid SequenceMAHQNQHQDTIDSTEVEVWDSRTAQEVNKSLYPPAVDSPFTLNTHLSAWRWACTIILGTVLVPVRVSCIVFLLILLWPVAVLSAINLPTQPTKPIRRWRKHLIKSALVFLFRLGFFFAGFLVKVKGKKATREEAPIFVSAPHSTFFDAIAVVVAGLPSVVSDSQLARVPLAGKCILVTQPVLVKREDPNSRKTTRNEILRRVKSKMKWPQILIFPEGLCTNRSCLVTFKLGAFSPGVPVQPVLLRYPNSLDTVTWTWNGFSGFQVCMLTLSQLFTRVEVEFMPVYIPSEEEKKDPILFANTVRIKMANALKLPVTDHSLEDCKLMISAGALQLPMEAGLVEFTKISQKLKLDWDNIHKHLDQYASFAVSSKGGKIGIEAFSRYLKLPISEPLRQLFSLFDRNQDGTIDFREYVIGLTVLCNPSNTEKILQMSFKLFDLDEDGYVTERELTTMLQAAFGVPDLDVSTLFQQMAGKDSDQVSYRTFRRFALKHPAYAKLFHSYIDLQAAYIYSLPREV

Function and Role

Lpcat2b, as an enzyme, functions as an acyltransferase that catalyzes the transfer of an acyl group to lysophosphatidylcholine (LPC), producing phosphatidylcholine (PC) . PC is a major component of cell membranes and is important for various cellular processes .

LPCAT2 influences macrophage inflammatory response to bacterial infection and is dependent on the LPS serotype . Macrophages play a key role in inflammatory conditions, including sepsis . It has been demonstrated that LPCAT2 is required for macrophage cytokine gene expression and release in response to TLR4 and TLR2 ligand stimulation . Cells overexpressing LPCAT2 exhibited increased expression of inflammatory genes in response to LPS and other bacterial ligands .

LPCAT2 is also involved in lipid droplet (LD) production . The LD content of cells positively correlates with the expression of LPCAT2, where it contributes to PC production. Downregulation of LPCAT2 expression is accompanied by a decrease in major PC species and a significant decrease in LD density .

Research Findings

  • Inflammation: LPCAT2 plays a key role in the inflammatory responses of macrophages to stimulation with bacterial ligands . It is required for cytokine gene expression in response to TLR4 and TLR2 ligand stimulation .

  • Lipid Droplet Production: LPCAT2 is essential for LD production in CRC cells . Overexpression of LPCAT2 enhances basal LD content .

  • ER Stress: Overexpression of LPCAT2 was associated with a reduction in ER-tracker MFI upon chemotherapy treatments, suggesting an alteration in ER stress pathway induction .

  • CD14 Regulation: LPCAT2 regulates CD14 gene and protein expression during macrophage activation .

Potential Applications

  • Drug Development: The role of LPCAT2 in inflammatory response suggests it may be a target for novel therapies .

  • Cancer Research: Given its involvement in lipid droplet production and chemoresistance, LPCAT2 is relevant in cancer research .

  • Sepsis Treatment: Targeting LPCAT2 may offer new strategies for treating sepsis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Lpcat2b; Aytl1b; Lysophosphatidylcholine acyltransferase 2B; Acyltransferase-like 1-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lpcat2b
Target Protein Sequence
MAHQNQHQDTIDSTEVEVWDSRTAQEVNKSLYPPAVDSPFTLNTHLSAWRWACTIILGTV LVPVRVSCIVFLLILLWPVAVLSAINLPTQPTKPIRRWRKHLIKSALVFLFRLGFFFAGF LVKVKGKKATREEAPIFVSAPHSTFFDAIAVVVAGLPSVVSDSQLARVPLAGKCILVTQP VLVKREDPNSRKTTRNEILRRVKSKMKWPQILIFPEGLCTNRSCLVTFKLGAFSPGVPVQ PVLLRYPNSLDTVTWTWNGFSGFQVCMLTLSQLFTRVEVEFMPVYIPSEEEKKDPILFAN TVRIKMANALKLPVTDHSLEDCKLMISAGALQLPMEAGLVEFTKISQKLKLDWDNIHKHL DQYASFAVSSKGGKIGIEAFSRYLKLPISEPLRQLFSLFDRNQDGTIDFREYVIGLTVLC NPSNTEKILQMSFKLFDLDEDGYVTERELTTMLQAAFGVPDLDVSTLFQQMAGKDSDQVS YRTFRRFALKHPAYAKLFHSYIDLQAAYIYSLPREV
Uniprot No.

Target Background

Function
Probable acetyltransferase.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the molecular characteristics of recombinant mouse LPCAT2?

Recombinant mouse LPCAT2 is typically expressed with a molecular mass of approximately 63 kDa . The protein has an isoelectric point of 9.5 and is membrane-associated, consistent with its role in phospholipid membrane remodeling . When produced as a recombinant protein, it is often expressed in prokaryotic systems such as E. coli with N-terminal His and GST tags to facilitate purification and downstream applications . The protein structure includes functional domains that mediate acyltransferase activity, membrane association, and interaction with signaling proteins including TLR4.

How stable is recombinant LPCAT2 under various experimental conditions?

Recombinant LPCAT2 stability is influenced by several factors including temperature, buffer composition, and freeze-thaw cycles. Storage studies indicate that the protein maintains stability when stored at 2-8°C for up to one month, but longer-term storage requires aliquoting and maintenance at -80°C . The thermal stability of LPCAT2 can be assessed through accelerated thermal degradation tests, which provide a loss rate measurement under controlled conditions . For experimental work, it is recommended to reconstitute lyophilized LPCAT2 in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL without vortexing to prevent protein denaturation .

What are the optimal methods for knocking down LPCAT2 expression in macrophage studies?

RNA interference (RNAi) technology has proven effective for studying LPCAT2 function through knockdown approaches. Successful protocols have utilized both siRNA and shRNA methodologies. For siRNA-mediated knockdown in murine macrophages (such as RAW264.7 cells), transfection with specific LPCAT2 siRNA sequences can achieve approximately 80% reduction in LPCAT2 mRNA expression . For stable knockdown, shRNA approaches have been successfully applied in human monocyte cell lines (e.g., MM6) .

The experimental protocol typically involves:

  • Design of target-specific siRNA sequences against LPCAT2 coding regions

  • Transfection optimization using appropriate reagents (concentration, incubation time)

  • Confirmation of knockdown efficiency by qRT-PCR and western blotting

  • Functional assays 24-72 hours post-transfection

Control experiments should include non-targeting siRNA/shRNA and validation of specificity by demonstrating unaltered expression of LPCAT1 and other related genes.

How can researchers effectively measure LPCAT2 enzymatic activity?

Quantification of LPCAT2 enzymatic activity requires specialized assays that measure the conversion of lysophosphatidylcholine to phosphatidylcholine. A methodological approach includes:

  • Preparation of membrane fractions from cells expressing LPCAT2

  • Incubation with radiolabeled or fluorescently labeled acyl-CoA and lysophosphatidylcholine substrates

  • Lipid extraction and separation by thin-layer chromatography

  • Quantification of reaction products by scintillation counting or fluorescence measurement

The assay conditions should be optimized for pH (typically 7.4), temperature (37°C), and substrate concentrations. Importantly, to distinguish LPCAT2 activity from other acyltransferases, researchers should include appropriate controls and consider using cells with LPCAT2 knockdown or specific inhibitors as negative controls.

What techniques are most effective for studying LPCAT2 translocation to membrane rafts?

To investigate LPCAT2 translocation to membrane lipid rafts in response to stimuli such as LPS, researchers can employ a combination of biochemical fractionation and imaging techniques:

  • Detergent-resistant membrane isolation:

    • Treat cells with cold 1% Triton X-100

    • Separate fractions through sucrose gradient ultracentrifugation

    • Analyze fractions for LPCAT2 and raft markers (e.g., flotillin, GM1)

  • Co-immunoprecipitation of LPCAT2 with TLR4:

    • Stimulate cells with LPS for various time periods (5-30 minutes)

    • Lyse cells and immunoprecipitate with anti-TLR4 antibodies

    • Detect associated LPCAT2 by western blotting

  • Confocal microscopy:

    • Express fluorescently tagged LPCAT2 in macrophages

    • Stain membrane rafts with cholera toxin B subunit

    • Analyze colocalization before and after LPS stimulation

Research has demonstrated that LPCAT2, but not LPCAT1, rapidly associates with TLR4 and translocates to membrane lipid raft domains in response to LPS stimulation, providing a mechanism for regulation of inflammatory gene expression .

How does LPCAT2 regulate macrophage inflammatory responses to bacterial ligands?

LPCAT2 plays a crucial role in regulating macrophage inflammatory responses specifically to TLR-mediated stimuli. Research using RNAi technology has demonstrated that LPCAT2 knockdown significantly inhibits cytokine gene expression and protein release in response to TLR4 and TLR2 ligands (LPS and LTA, respectively), but not to TLR-independent stimuli .

The regulatory mechanism appears to involve:

  • Rapid association of LPCAT2 with TLR4 following LPS stimulation

  • Translocation of the LPCAT2-TLR4 complex to membrane lipid rafts

  • Modulation of downstream signaling cascades, including p38 MAPK phosphorylation

Knockdown experiments show that LPCAT2 depletion results in significant but incomplete inhibition of inflammatory gene expression (approximately 80% reduction), suggesting that while LPCAT2 plays a major role, other molecules may also contribute to these responses . Importantly, this regulatory function appears conserved across both murine and human macrophages, indicating a fundamental mechanism in innate immune cell function.

What is the relationship between LPCAT2 expression levels and inflammatory cytokine production?

The relationship between LPCAT2 expression and inflammatory cytokine production demonstrates a direct correlation. Experimental data shows that:

  • Knockdown effects: LPCAT2 siRNA-transfected RAW264.7 macrophages exhibit significantly reduced pro-inflammatory cytokine (TNF-α, IL-6) expression and release in response to LPS stimulation .

  • Overexpression effects: Conversely, cells transfected to overexpress LPCAT2 show enhanced expression of inflammatory genes in response to LPS and other bacterial ligands .

  • Temporal relationship: LPCAT2 mRNA expression is induced by TLR ligands within 6 hours of stimulation, preceding the peak of many inflammatory cytokines .

This relationship is specific to TLR-mediated pathways, as LPCAT2 knockdown inhibits LPS-induced ROS production but not PMA-induced (TLR-independent) ROS production. Furthermore, LPCAT2 regulation operates upstream of p38 MAPK phosphorylation, suggesting it functions early in the inflammatory signaling cascade .

How can researchers differentiate between LPCAT1 and LPCAT2 functions in inflammatory processes?

Distinguishing between LPCAT1 and LPCAT2 functions requires careful experimental design:

  • Expression analysis:
    Quantitative real-time PCR with isoform-specific primers can determine absolute transcript levels. In resting macrophages, LPCAT1 is expressed approximately eight-fold higher than LPCAT2, but only LPCAT2 is significantly upregulated by TLR ligands .

  • Selective knockdown:
    Independent siRNA targeting of each isoform reveals that LPCAT2 knockdown, but not LPCAT1 knockdown, inhibits inflammatory cytokine production in response to TLR stimulation .

  • Protein interaction studies:
    Immunoprecipitation and western blotting demonstrate that LPCAT2, but not LPCAT1, physically associates with TLR4 following LPS stimulation .

  • Subcellular localization:
    Following TLR stimulation, LPCAT2 selectively translocates to membrane lipid rafts, a phenomenon not observed with LPCAT1 .

This methodological approach has established that despite structural similarities, LPCAT1 and LPCAT2 have distinct roles in inflammatory responses, with LPCAT2 specifically regulating TLR-mediated inflammation.

What is the evidence for LPCAT2 as a therapeutic target in inflammatory conditions?

Multiple lines of evidence support LPCAT2 as a potential therapeutic target for inflammatory conditions, particularly sepsis:

  • LPCAT2 knockdown significantly reduces pro-inflammatory cytokine production in response to bacterial ligands that are crucial in sepsis pathogenesis .

  • The specificity of LPCAT2 for TLR-mediated responses suggests that targeting this enzyme may inhibit pathogen-induced inflammation while preserving other essential immune functions .

  • LPCAT2's role appears conserved across murine and human cell types, indicating translational potential for human therapeutics .

  • As LPCAT2 functions upstream in inflammatory signaling cascades, its inhibition may provide broader anti-inflammatory effects than targeting individual downstream cytokines .

  • Initial evidence suggests LPCAT2 may control chemoresistance in colorectal cancer, indicating potential applications beyond acute inflammatory conditions .

The selective nature of LPCAT2 in inflammatory regulation makes it particularly attractive as a therapeutic target, as inhibition might not affect constitutive cellular functions mediated by other acyltransferases like LPCAT1.

How does LPCAT2 contribute to membrane remodeling during inflammatory activation?

LPCAT2 facilitates membrane remodeling during inflammatory activation through several mechanisms:

  • Phospholipid remodeling activity: LPCAT2 catalyzes the conversion of lysophosphatidylcholine to phosphatidylcholine by transferring an acyl group from acyl-CoA to the sn-2 position of lysophosphatidylcholine.

  • Membrane raft reorganization: Following LPS stimulation, LPCAT2 rapidly translocates to membrane lipid rafts, microdomains critical for TLR4 signaling complex formation .

  • TLR4 association: LPCAT2 physically associates with TLR4 in response to LPS, potentially altering receptor conformation or spatial organization within the membrane .

This membrane remodeling activity likely facilitates the assembly of signaling complexes required for TLR-mediated inflammatory responses. The specific enrichment of LPCAT2 (but not LPCAT1) in membrane rafts following LPS stimulation suggests a specialized role in inflammation-induced membrane reorganization that supports signal transduction .

What quantitative approaches can accurately measure relative and absolute LPCAT expression?

Accurate quantification of LPCAT expression requires sophisticated methodologies that enable both relative and absolute measurements:

  • Relative quantification by qRT-PCR:

    • Design isoform-specific primers that distinguish between LPCAT1 and LPCAT2

    • Normalize to stable reference genes (e.g., GAPDH, β-actin)

    • Calculate fold changes using the 2^-ΔΔCt method

  • Absolute quantification:
    The method described in the literature involves:

    • Creating a standard curve using a known concentration of a 100 bp PCR product

    • Preparing a 7-point standard by serial dilutions (1:5) ranging from 0.8 ng/μL to 5.12×10^-5 ng/μL

    • Calculating concentration using the formula: 10^((Ct-b)/m), where Ct is the threshold number, b is y-intercept, and m is slope

    • Converting to copy number using molecular weights (LPCAT1 = 33004.2 g/mol, LPCAT2 = 32564 g/mol), actual mass, cell density, and Avogadro's number

  • Protein quantification:

    • Western blotting with isoform-specific antibodies

    • Densitometric analysis with recombinant protein standards

    • Normalization to housekeeping proteins

This quantitative approach revealed that in resting macrophages, LPCAT1 transcript levels are approximately eight-fold higher than LPCAT2, providing important context for functional studies .

How should researchers design experiments to investigate LPCAT2's role in TLR signaling pathways?

A comprehensive experimental design to investigate LPCAT2's role in TLR signaling should include:

  • Temporal analysis:

    • Examine LPCAT2 expression, localization, and TLR4 association at multiple time points (5 min, 15 min, 30 min, 1h, 6h, 24h) after stimulation

    • Correlate with activation of downstream signaling molecules (MAPKs, NF-κB)

  • Gain and loss of function approaches:

    • siRNA or shRNA knockdown of LPCAT2

    • Overexpression of wild-type LPCAT2

    • Expression of catalytically inactive LPCAT2 mutants

    • CRISPR/Cas9-mediated knockout for complete elimination

  • Pathway analysis:

    • Examine multiple TLR pathways (TLR2, TLR4, TLR9) to determine specificity

    • Include TLR-independent stimuli (e.g., PMA) as controls

    • Assess impact on multiple downstream readouts (cytokine expression, MAPK phosphorylation, ROS production)

  • Mechanistic studies:

    • Membrane fractionation to assess lipid raft translocation

    • Co-immunoprecipitation to identify protein interactions

    • Lipidome analysis to assess changes in membrane composition

  • Validation across systems:

    • Test in multiple cell types (RAW264.7, primary murine macrophages, human monocytes)

    • Consider in vivo models (e.g., conditional knockout mice)

This multi-faceted approach has successfully demonstrated that LPCAT2 selectively regulates TLR-mediated inflammatory responses by associating with TLR4 and translocating to membrane lipid rafts .

What are the key considerations when interpreting LPCAT2 functional data in different experimental systems?

When interpreting LPCAT2 functional data, researchers should consider several important factors:

  • Cell type differences:

    • Expression levels of LPCAT2 vary across cell types

    • The RAW264.7 macrophage line, murine peritoneal macrophages, and human MM6 cells all show LPCAT2-dependent inflammatory responses, but with potential quantitative differences

    • Primary cells may exhibit different baseline expression and induction kinetics compared to cell lines

  • Knockdown efficiency:

    • Incomplete knockdown (e.g., 80% reduction) may yield partial phenotypes

    • Residual LPCAT2 activity may be sufficient for some functions

    • Consider complementary approaches (pharmacological inhibition, CRISPR knockout)

  • Species differences:

    • While the role of LPCAT2 appears conserved between mouse and human systems, species-specific differences in regulation may exist

    • Sequence variations may affect antibody recognition and inhibitor specificity

  • Redundancy and compensation:

    • Other enzymes may partially compensate for LPCAT2 deficiency

    • Long-term LPCAT2 depletion may trigger compensatory upregulation of related enzymes

  • Context-dependent functions:

    • LPCAT2's role may differ in acute vs. chronic inflammation

    • Its function in cancer cells (e.g., chemoresistance in colorectal cancer) may involve different mechanisms than in immune cells

These considerations are crucial for accurate interpretation of experimental results and for translating findings from model systems to potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.