Recombinant Mouse Lysophospholipid acyltransferase LPCAT4 (Lpcat4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Lpcat4; Agpat7; Aytl3; Lysophospholipid acyltransferase LPCAT4; 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-alkenylglycerophosphoethanolamine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acyltransferase-like 3; Lysophosphatidylcholine acyltransferase 4; Lysophosphatidylethanolamine acyltransferase 2; Plasmalogen synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lpcat4
Target Protein Sequence
MSQGSPGAWAPLDPTSGSSASPNPFVHELHLSGLQRVKFCLLGVLLAPIRVLLAFIVLFL LWPFAWLQVAGLTEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLE APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYQPSLEESKDPTLYANNVQRVMAQALGIP ATECEFVGSLPVIVVGQLKVALEPQLWELAKVLQKAGLSPGFVDMGAEPGRSRMISQEAF AQQLQLSDPQTVAGAFSYFQQDAKGLVDFRNVALALAALDGGRSLEELTRLAFELFAEEQ AEGSDRLLYKDGFSTILHLLLGSPRPAATTLHAELCQPGCSQGLSLCQFQNFSLHDPLYG KLFSAYLRPPHKPRSTSQIPNASSPSSPTALANGTVQAPKQKGD
Uniprot No.

Target Background

Function
This recombinant mouse lysophospholipid acyltransferase LPCAT4 (Lpcat4) exhibits acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates. It catalyzes the conversion of lysophosphatidylethanolamine to phosphatidylethanolamine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol to phosphatidylglycerol, and alkyl-lysophosphatidylcholine to alkyl-phosphatidylcholine. Conversely, it lacks lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol, and lysophosphatidic acid acyltransferase activity. It preferentially utilizes long-chain acyl-CoAs (C16, C18) as acyl donors and converts lysophosphatidylcholine to phosphatidylcholine.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with much higher level in brain. Expressed in erythroleukemic cells but not in reticulocytes.

Q&A

What is LPCAT4 and what is its primary function?

LPCAT4 (also known as AGPAT7, AYTL3, and LPEAT2) is a member of the lysophospholipid acyltransferase family that catalyzes the conversion of lysophospholipids to phospholipids in the lipid remodeling pathway. Specifically, LPCAT4 converts lysophosphatidylcholine (LPC) to phosphatidylcholine (PC) and lysophosphatidylethanolamine (LPE) to phosphatidylethanolamine (PE) . It plays a crucial role in maintaining membrane phospholipid composition and diversity, which is essential for various cellular functions. LPCAT4 is distinct from other LPLATs as it does not possess LPAAT motifs typically found in other acyltransferases .

How does LPCAT4 differ from other members of the LPCAT family?

While all four LPCAT isoforms (LPCAT1-4) catalyze the conversion of lysophosphatidylcholine to phosphatidylcholine, they exhibit distinct substrate preferences and tissue expression patterns:

  • LPCAT3 exhibits activity for LPC, LPE, and LPS with a preference for polyunsaturated fatty acyl-CoAs (18:2 and 20:4)

  • LPCAT4 shows LPCAT and LPEAT activities with a preference for oleoyl-CoA (18:1)

  • LPEAT1 (another family member) demonstrates LPEAT and LPSAT activities with a preference for oleoyl-CoA

These differences allow each enzyme to contribute uniquely to membrane phospholipid composition and remodeling.

What are effective methods for modulating LPCAT4 expression in experimental models?

Researchers can employ several approaches to modulate LPCAT4 expression:

  • RNA interference (RNAi): Small interfering RNAs (siRNAs) can effectively knockdown LPCAT4 expression. These siRNAs interfere with LPCAT4 gene expression by degrading its mRNA after transcription, preventing translation . For enhanced stability and reduced immunogenicity, Ribo-modified siRNAs targeting LPCAT4 are available .

  • Stable shRNA knockdown: Establishing stable shRNA knockdown cell lines provides a persistent reduction in LPCAT4 expression. Studies have demonstrated successful knockdown to approximately 50% of normal expression levels across multiple cell lines .

  • Recombinant protein expression: For gain-of-function studies, recombinant LPCAT4 protein can be expressed in prokaryotic systems like E. coli, purified, and used for in vitro enzymatic assays or as a positive control in experiments .

How can LPCAT4 activity be measured in experimental settings?

LPCAT4 enzymatic activity can be measured using:

  • LPLAT activity assays: These assays measure the conversion of lysophospholipids to phospholipids using various lysophospholipids as acceptors and acyl-CoAs as donors. The activity is typically measured by monitoring the incorporation of radiolabeled acyl-CoAs into phospholipids .

  • Lipidomic analysis: Liquid chromatography-mass spectrometry (LC-MS/MS) can be used to analyze changes in phospholipid composition following LPCAT4 manipulation. This approach can detect specific alterations in phospholipid species, such as the reduction in PC 18:1_18:1 molecules observed in LPCAT4 knockdown cells .

  • Functional assays: Since LPCAT4 influences cellular functions, assays measuring proliferation (MTT assay), colony formation, and barrier function (transepithelial electrical resistance) can indirectly assess the functional consequences of LPCAT4 activity .

What considerations should be made when designing LPCAT4 knockdown experiments?

When designing LPCAT4 knockdown experiments, researchers should consider:

  • Knockdown efficiency: Complete LPCAT4 knockout may be challenging or lethal, as demonstrated by studies achieving approximately 50-60% knockdown . Verification of knockdown should include both mRNA (RT-qPCR) and protein (Western blot) analyses.

  • Cell type-specific effects: LPCAT4 expression and function may vary across cell types. For example, in urothelial cells, LPCAT4 knockdown impairs proliferation but enhances barrier function .

  • Compensatory mechanisms: Other LPCAT family members may compensate for reduced LPCAT4 expression, potentially confounding experimental results. Comprehensive analysis of all LPCAT isoforms is recommended.

  • Downstream pathway analysis: Consider examining effects on related pathways. LPCAT4 knockdown has been associated with altered PKC activity, TSPO abundance, and changes in cholesterol biosynthesis .

How does LPCAT4 contribute to membrane phospholipid remodeling?

LPCAT4 participates in the Lands' cycle, a phospholipid remodeling pathway that maintains membrane phospholipid composition and asymmetry. In this cycle:

  • Phospholipases remove fatty acids from phospholipids, generating lysophospholipids.

  • LPCAT4 reacylates these lysophospholipids, primarily using oleoyl-CoA (18:1) as the acyl donor .

  • This process results in the incorporation of specific fatty acid chains into membrane phospholipids, particularly enriching membranes with monounsaturated (18:1) phospholipid species .

The selective substrate preference of LPCAT4 for oleoyl-CoA contributes to the diversity and asymmetry of glycerophospholipids in cellular membranes, which is critical for membrane fluidity, curvature, and function .

What is the relationship between LPCAT4 and cellular barrier function?

Studies in urothelial cells have revealed a complex relationship between LPCAT4 and epithelial barrier function:

  • LPCAT4 knockdown urothelial cultures exhibited an impaired proliferation rate but developed elevated trans-epithelial electrical resistances (TEER) upon differentiation .

  • These cultures showed a reduced and delayed capacity to restitute barrier function after wounding, suggesting that while baseline barrier function may be enhanced, the ability to repair the barrier is compromised .

  • The specific reduction in 18:1 PC fatty acyl chains upon LPCAT4 knockdown is consistent with LPCAT4's enzymatic specificity but was unlikely to directly cause the broad barrier function changes observed .

  • Transcriptomic analysis of LPCAT4 knockdown supported an LPC-induced reduction in diacylglycerol (DAG) availability, which was predicted to limit protein kinase C (PKC) activity, and translocator protein (TSPO) abundance, predicted to limit endogenous ATP .

These findings suggest that LPCAT4 influences barrier function through its effects on lipid mediators and downstream signaling pathways rather than through direct changes in membrane composition.

What molecular pathways are regulated by LPCAT4?

LPCAT4 has been implicated in regulating several molecular pathways:

  • Cell cycle and proliferation: Differential gene expression analysis between high and low LPCAT4-expressing cells revealed enrichment in pathways related to mitotic nuclear division, nuclear division, and cell cycle regulation .

  • DNA metabolic processes: LPCAT4 influences genes involved in the regulation of DNA metabolic processes and deoxyribonucleotide metabolic processes .

  • Lipid metabolism: Beyond its direct role in phospholipid remodeling, LPCAT4 has been shown to enhance cholesterol biosynthesis by up-regulating ACSL3 in hepatocellular carcinoma through the WNT/β-catenin/c-JUN signaling pathway .

  • PPAR signaling: KEGG pathway analysis of genes differentially expressed in relation to LPCAT4 showed enrichment in the PPAR signaling pathway, which plays a crucial role in lipid metabolism and adipocyte differentiation .

Understanding these molecular interactions provides insight into how LPCAT4 influences cellular processes beyond its enzymatic function in phospholipid remodeling.

What is the role of LPCAT4 in cancer progression?

LPCAT4 has been implicated in cancer progression through multiple mechanisms:

These findings highlight LPCAT4 as a potential therapeutic target in cancer, particularly in HCC.

How does LPCAT4 expression correlate with clinical outcomes in cancer patients?

Analysis of LPCAT4 expression in relation to clinical outcomes has revealed:

The table below summarizes the expression changes of LPCAT4 in cancer tissues:

Gene NameType of Cancer vs Normal TissueFold ChangeP valuet-testReference
LPCAT1HCC vs normal liver2.3694.23E-65.32017393520
LPCAT1HCC vs normal liver2.3591.18E-4215.63921159642
LPCAT1HCC vs normal liver2.6763.15E-65.45721159642

Note: While this table primarily shows LPCAT1 data, the search results indicate that LPCAT4 protein was also strongly expressed in HCC tissues compared to moderate expression in normal liver tissues .

How do LPCAT4 and other LPCAT family members contribute to immune responses in the tumor microenvironment?

The LPCAT family, including LPCAT4, influences immune responses in the tumor microenvironment:

  • Immunotherapy biomarker: LPCATs scores function as prognostic markers for immune checkpoint inhibitor (ICI) therapies in cancer patients, suggesting that these enzymes may modulate responses to immunotherapy .

  • Tumor microenvironment adaptation: PC metabolic dysregulation and resulting modifications in membrane composition facilitate the ability of cancerous cells to adapt to the local tumor microenvironment (TME) .

  • Potential immunomodulatory functions: While not explicitly detailed in the provided search results, the role of LPCAT4 in phospholipid remodeling may influence immune cell function, as membrane lipid composition affects immune cell signaling, activation, and function.

These connections between LPCAT4, lipid metabolism, and immune responses highlight the potential of targeting LPCAT4 in combination with immunotherapeutic approaches for cancer treatment.

How can transcriptomic and lipidomic analyses be integrated to understand LPCAT4 function?

Integrated multi-omics approaches provide powerful insights into LPCAT4 function:

  • Complementary data generation: Conduct parallel lipidomic analyses (LC-MS/MS) to profile phospholipid species and transcriptomic analyses (RNA-seq) of LPCAT4-modulated cells .

  • Correlation of lipid changes with gene expression: Identify relationships between LPCAT4-dependent alterations in specific lipid species (e.g., reduction in PC 18:1_18:1) and changes in gene expression patterns .

  • Pathway analysis: Use bioinformatic tools to identify enriched biological processes and pathways from transcriptomic data that may be linked to LPCAT4-mediated changes in lipid composition .

  • Validation of predicted mechanisms: Confirm predicted alterations in molecular pathways through targeted biochemical assays, such as validating reduced PKC activity or TSPO abundance following LPCAT4 knockdown .

This integrated approach has successfully revealed LPCAT4's role beyond direct lipid modifications, such as its influence on DAG availability, PKC activity, and ATP production, highlighting the strength of combined lipidomic and transcriptomic analyses for characterizing tissue homeostasis .

What are the considerations for developing LPCAT4-targeted therapeutics?

Development of LPCAT4-targeted therapeutics should consider:

  • Specificity challenges: LPCAT4 shares functional similarities with other LPCAT family members, making the development of specific inhibitors challenging. Therapeutic approaches must distinguish between LPCAT isoforms to minimize off-target effects.

  • Tissue expression patterns: LPCAT4 expression varies across tissues, with implications for potential side effects. Understanding tissue-specific roles is essential for predicting therapeutic outcomes.

  • Pathway redundancy: The existence of compensatory lipid remodeling pathways may limit the efficacy of LPCAT4 inhibition. Combination approaches targeting multiple nodes in lipid metabolism may be necessary.

  • Cancer-specific applications: Given LPCAT4's role in cancer progression, particularly in HCC , cancer-specific delivery of LPCAT4 inhibitors could enhance therapeutic efficacy while minimizing systemic effects.

  • Potential immunomodulatory effects: The connection between LPCAT4 and immunotherapy responses suggests that LPCAT4 inhibition might enhance the efficacy of immune checkpoint inhibitors, indicating potential for combination therapy approaches.

What are the potential applications of recombinant LPCAT4 protein in biochemical and structural studies?

Recombinant LPCAT4 protein offers numerous applications in advanced research:

  • Enzymatic activity characterization: Purified recombinant LPCAT4 enables detailed kinetic studies, determination of substrate specificities, and identification of cofactor requirements under controlled conditions .

  • Inhibitor screening: Recombinant LPCAT4 can serve as a target for high-throughput screening of potential inhibitors, facilitating drug discovery efforts.

  • Structural biology applications: Purified protein can be used for crystallography or cryo-electron microscopy studies to determine LPCAT4's three-dimensional structure, providing insights into its catalytic mechanism and informing structure-based drug design.

  • Interaction studies: Recombinant LPCAT4 enables investigation of protein-protein interactions through techniques such as pull-down assays, co-immunoprecipitation, or surface plasmon resonance.

  • Antibody generation and validation: Highly purified recombinant LPCAT4 serves as an excellent immunogen for antibody production and as a standard for antibody validation .

These applications of recombinant LPCAT4 protein contribute to our fundamental understanding of this enzyme's function and facilitate the development of targeted therapeutic approaches.

What are the unexplored aspects of LPCAT4 biology that warrant further investigation?

Several aspects of LPCAT4 biology remain to be fully elucidated:

  • Regulatory mechanisms: The transcriptional, post-transcriptional, and post-translational regulation of LPCAT4 expression and activity remains poorly understood. Investigating these regulatory mechanisms would provide insights into how LPCAT4 function is modulated in different physiological and pathological contexts.

  • Tissue-specific functions: While LPCAT4's role has been studied in urothelial cells and liver cancer , its function in other tissues remains largely unexplored. Tissue-specific knockout models could reveal novel physiological roles.

  • Developmental biology: The role of LPCAT4 in embryonic development and tissue differentiation has not been extensively studied. Given its upregulation during urothelial differentiation , LPCAT4 may play important roles in other differentiation processes.

  • Non-enzymatic functions: Beyond its catalytic activity in phospholipid remodeling, LPCAT4 may have non-enzymatic functions through protein-protein interactions that have yet to be characterized.

  • Role in non-cancer diseases: While LPCAT4's role in cancer has received attention, its potential contribution to other diseases, particularly those involving lipid metabolism dysregulation, warrants investigation.

How might novel technologies advance our understanding of LPCAT4 function?

Emerging technologies offer new opportunities to investigate LPCAT4:

  • CRISPR-Cas9 genome editing: Precise genetic manipulation enables the creation of cell and animal models with specific LPCAT4 mutations or conditional knockout systems to study its function in various contexts.

  • Single-cell multi-omics: Combining single-cell transcriptomics with lipidomics could reveal cell-specific roles of LPCAT4 and heterogeneity in its function within tissues.

  • Advanced imaging techniques: Super-resolution microscopy and correlative light and electron microscopy could clarify LPCAT4's subcellular localization and its spatial relationship with other cellular components.

  • Organoid models: Three-dimensional organoid cultures provide physiologically relevant systems to study LPCAT4's role in tissue organization and function, particularly in epithelial barrier formation.

  • Computational modeling: Molecular dynamics simulations and systems biology approaches could predict LPCAT4's behavior in complex biological systems and its impact on global lipid metabolism.

These technologies promise to enhance our understanding of LPCAT4's multifaceted roles in cellular physiology and disease pathophysiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.