Recombinant Mouse Lysoplasmalogenase-like protein TMEM86A (Tmem86a)

Shipped with Ice Packs
In Stock

Description

Functional Insights

3.1. Enzymatic Activity
TMEM86A catalyzes the hydrolysis of lysoplasmalogens (e.g., LPE P-18:0) into plasmanyl phospholipids:

  • Mechanism: D82 and D190 are critical for activity; mutations (D82A/D190A) reduce lysoplasmalogenase function .

  • Substrate Specificity: Preferentially targets plasmenyl lysophosphatidylethanolamine (LPE P-18:0) .

3.2. Role in Lipid Metabolism

  • Plasmalogen Remodeling: Overexpression reduces lysoplasmalogens and increases plasmanyl PC/PE, altering membrane fluidity .

  • Adipocyte Function: Knockout (TMEM86A AKO) in mice elevates lysoplasmalogen levels, enhancing mitochondrial oxidative metabolism and thermogenesis .

Physiological and Pathological Implications

4.1. Metabolic Regulation

  • High-Fat Diet Response: TMEM86A expression rises in adipocytes during obesity, linking it to lipid remodeling in metabolic stress .

  • Energy Expenditure: TMEM86A AKO mice exhibit increased energy expenditure, reduced adiposity, and improved insulin sensitivity under high-fat diets .

4.2. LXR-Dependent Regulation

  • Sterol Sensitivity: TMEM86A is a direct target of Liver X Receptor (LXR) in macrophages, influencing membrane composition during cholesterol overload .

4.3. Human Relevance

  • Obesity Biomarker: Adipose lysoplasmalogen levels (e.g., LPE P-18:0) are reduced in obese humans, suggesting TMEM86A as a therapeutic target .

Research Applications

5.1. Experimental Models

  • In Vitro Studies: Recombinant TMEM86A is used to study lysoplasmalogenase activity in lipid profiling assays (e.g., LC-MS) .

  • Knockout Models: Adipocyte-specific TMEM86A AKO mice enable mechanistic studies of plasmalogen metabolism in vivo .

5.2. Therapeutic Potential

  • Lysoplasmalogen Supplementation: Exogenous LPE P-18:0 mimics TMEM86A AKO effects, improving metabolic outcomes in obesity models .

Key Research Findings

ParameterObservationSource
Enzyme ActivityTMEM86A hydrolyzes LPE P-18:0; D82A/D190A mutations reduce activity by ~50%.
Metabolic ImpactTMEM86A AKO increases mitochondrial proteins (MCAD, UCP1) and energy expenditure.
LXR RegulationTMEM86A expression is LXR-dependent in macrophages.
Human RelevanceLPE P-18:0 levels are lower in obese adipose tissue.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Tmem86a; Lysoplasmalogenase-like protein TMEM86A; Transmembrane protein 86A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem86a
Target Protein Sequence
MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGVR FLLAHPSASLIFVGLVFSAVGDAFLIWQDHGYFEHGLLMFAVAHILYAAAFGMRPLALRT GLVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISFMGWRAMAGLRLVGAAWRWTELAAG GGALLFILSDLTIALNKFCFPVPYSRALIMSTYYAAQMLIALSAVESREPVGEDYRLSKA D
Uniprot No.

Target Background

Database Links
Protein Families
TMEM86 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM86A and what is its primary enzymatic function?

TMEM86A (transmembrane protein 86A) functions as a bona fide lysoplasmalogenase that catalyzes the degradation of lysoplasmalogens, particularly lysoplasmalogen species such as LPE P-18:0 (1-(1Z-octadecenyl)-sn-glycero-3-phosphoethanolamine) and LPC P-18:0 (1-(1Z-octadecenyl)-sn-glycero-3-phosphocholine) . This enzymatic activity has been confirmed through comprehensive global phospholipid profiling and direct enzymatic assays in both gain- and loss-of-function analyses .

The lysoplasmalogenase activity of TMEM86A regulates the levels of bioactive lysoplasmalogens, which play crucial roles in membrane fluidity and signaling pathways. From an evolutionary perspective, TMEM86A is a member of the YhhN family proteins found across species ranging from bacteria to mammals, with TMEM86B being its closest homolog with established lysoplasmalogenase activity .

What is the subcellular localization of TMEM86A?

TMEM86A is predominantly localized to the endoplasmic reticulum (ER) . This localization has been experimentally verified using green fluorescent protein (GFP)-tagged TMEM86A, which strongly colocalizes with ER Tracker staining in C3H10T1/2 cells both before and after differentiation . This subcellular positioning is consistent with its function in lipid metabolism, as the ER is a major site for phospholipid synthesis and remodeling.

What is the predicted structural organization of TMEM86A?

The three-dimensional structure of TMEM86A has been computationally predicted with high confidence using AlphaFold models . These predictions reveal that TMEM86A contains 8 transmembrane regions, consistent with its function as an integral membrane protein . The catalytic site comprises evolutionarily conserved residues, particularly D82 and D190, which are juxtaposed within the predicted transmembrane region . These residues are absolutely conserved between bacterial and mammalian YhhN lysoplasmalogenases, highlighting their importance in the enzymatic function .

How is TMEM86A expression regulated in different tissues?

TMEM86A expression exhibits tissue-specific regulation and is significantly influenced by metabolic status. Research has demonstrated that high-fat diet (HFD) feeding upregulates TMEM86A expression specifically in white adipose tissue (WAT) . RNA-seq analysis of gonadal white adipose tissue (gWAT) from mice fed normal chow diet versus HFD for 8 weeks revealed that Tmem86a expression is significantly increased in response to HFD .

Additionally, TMEM86A has been identified as a direct transcriptional target of liver X receptor (LXR) in macrophages and microglia . The LXR transcription factors are important regulators of cellular lipid homeostasis, linking sterol metabolism to lysoplasmalogen catabolism through TMEM86A regulation .

What experimental approaches are most effective for studying TMEM86A function?

Several complementary approaches have proven effective for investigating TMEM86A function:

  • Genetic manipulation models:

    • Adipocyte-specific TMEM86A knockout (TMEM86A AKO) mice, created by crossing Tmem86a flox/flox mice with adipoq-Cre mice

    • RNA interference using shRNA for Tmem86a silencing in cell culture models

    • Overexpression systems using lentiviral transduction in various cell types

  • Enzymatic activity assessment:

    • Direct measurement of lysoplasmalogenase activity using LPE P-18:0 as substrate and LC-MS analysis

    • Catalytic site mutagenesis (D82A or D190A) to confirm specific residues involved in enzymatic function

  • Lipidomic profiling:

    • Untargeted phospholipid profiling to detect changes in lysoplasmalogen content

    • Principal component analysis (PCA) to distinguish lipid profiles between experimental groups

  • Molecular imaging:

    • Subcellular localization using GFP-tagged TMEM86A and colocalization with ER markers

  • Physiological assessment:

    • Metabolic phenotyping using indirect calorimetry for whole-body energy metabolism

    • Glucose and insulin tolerance tests for metabolic function evaluation

How can researchers effectively generate and validate TMEM86A knockout models?

Generating effective TMEM86A knockout models requires careful design and comprehensive validation:

Generation Strategy:

  • Design of tissue-specific knockout using Cre-loxP system (e.g., adipocyte-specific deletion using adiponectin-Cre)

  • Verification of efficient deletion at genomic level through PCR-based genotyping

  • Confirmation of protein deletion through western blot analysis in target tissues (BAT, iWAT, gWAT)

Validation Approaches:

  • Molecular validation: Confirm absence of TMEM86A protein in target tissues while maintaining expression in non-targeted tissues

  • Biochemical validation: Demonstrate increased lysoplasmalogen content in knockout tissues through lipidomic analysis

  • Functional validation: Assess physiological consequences such as changes in mitochondrial protein content, PKA signaling, and metabolic parameters

Expected Phenotypic Changes:

  • Increased lysoplasmalogen content in adipose tissue

  • Enhanced PKA signaling through inhibition of PDE3B

  • Upregulated mitochondrial oxidative metabolism

  • Increased energy expenditure

  • Protection from metabolic dysfunction induced by high-fat feeding

What methodologies are recommended for analyzing TMEM86A-mediated changes in lysoplasmalogen metabolism?

Comprehensive analysis of TMEM86A-mediated effects on lysoplasmalogen metabolism requires sophisticated lipidomic approaches:

Comparative analysis of the most significantly altered lysoplasmalogen species in TMEM86A AKO tissues:

LysoplasmalogenBAT Fold ChangeiWAT Fold ChangegWAT Fold Change
LPE P-18:0>2.0*>2.0*>2.0*
LPC P-18:0>2.0*>2.0*>2.0*

*All changes with FDR < 0.05

How can the enzymatic activity of TMEM86A be measured in vitro?

Measuring TMEM86A lysoplasmalogenase activity requires specialized approaches:

  • Overexpression system:

    • Transfect cells (e.g., HEK293T or adipocyte cell lines) with TMEM86A expression vectors

    • Include catalytic site mutants (D82A, D190A) as negative controls

  • Substrate challenge assay:

    • Challenge cells with exogenous lysoplasmalogen substrate (e.g., LPE P-18:0)

    • Measure residual substrate levels in conditioned media at defined timepoints using LC-MS analysis

    • Calculate substrate catabolism by subtracting residual levels from initial concentrations

  • In vitro enzymatic assay:

    • Isolate membrane fractions from cells expressing TMEM86A

    • Incubate with defined concentrations of lysoplasmalogen substrates

    • Quantify substrate disappearance or product formation using LC-MS

  • Controls and validation:

    • Use mock-transfected cells as negative controls

    • Validate specificity using catalytic site mutants (D82A, D190A)

    • Confirm that enzymatic activity correlates with TMEM86A expression levels

How does TMEM86A affect adipose tissue metabolism and function?

TMEM86A plays a pivotal role in adipose tissue metabolism through several interconnected mechanisms:

  • Regulation of lysoplasmalogen levels:

    • TMEM86A degrades lysoplasmalogens in adipose tissue

    • High-fat diet increases TMEM86A expression, reducing lysoplasmalogen levels

    • TMEM86A knockout increases lysoplasmalogen content in brown and white adipose tissues

  • Impact on PKA signaling:

    • Lysoplasmalogen accumulation in TMEM86A AKO adipose tissue potentiates PKA signaling

    • This occurs through inhibition of phosphodiesterase 3B (PDE3B), the major enzyme degrading cAMP in adipocytes

    • Enhanced PKA signaling is evidenced by increased phosphorylation of hormone-sensitive lipase (HSL) and CREB in TMEM86A AKO tissues

  • Effects on mitochondrial function:

    • TMEM86A AKO increases levels of mitochondrial proteins involved in oxidative phosphorylation and thermogenesis

    • Upregulated proteins include MCAD, ATP5A, UQCRC2, SDHB, NDUFB8, COXIV, and UCP1

    • These changes are consistent with increased mitochondrial oxidative activity

  • Whole-body metabolic effects:

    • TMEM86A AKO mice exhibit increased energy expenditure

    • They are protected from high-fat diet-induced metabolic dysfunction

    • Treatment with lysoplasmalogen (the substrate of TMEM86A) similarly protects mice from HFD-induced metabolic dysfunction

What is the relationship between TMEM86A and sterol metabolism?

TMEM86A serves as a molecular link between sterol metabolism and lysoplasmalogen catabolism:

  • Transcriptional regulation by LXR:

    • TMEM86A has been identified as a direct transcriptional target of liver X receptor (LXR) in macrophages and microglia

    • LXR activation induces TMEM86A expression, leading to reduced lysoplasmalogen levels

  • Role in sterol-dependent membrane remodeling:

    • TMEM86A contributes to sterol-dependent membrane remodeling through its regulation of lysoplasmalogen levels

    • Changes in lysoplasmalogen abundance affect membrane fluidity

    • Overexpression of TMEM86A reduces membrane fluidity, while silencing increases it

  • Expression in atherosclerotic plaques:

    • TMEM86A is highly expressed in TREM2+/lipid-associated macrophages in human atherosclerotic plaques

    • Its expression positively correlates with other LXR-regulated genes in these lesions

  • Functional implications:

    • This sterol-regulated lysoplasmalogenase activity represents a novel mechanism for controlling membrane composition in response to changing sterol levels

    • It may contribute to macrophage adaptation to lipid-rich environments in atherosclerotic plaques

What molecular techniques are most effective for studying TMEM86A protein-protein interactions?

While the provided search results don't specifically address protein-protein interactions of TMEM86A, several approaches would be methodologically sound for investigating these interactions:

  • Co-immunoprecipitation (Co-IP):

    • Generate tagged versions of TMEM86A (e.g., FLAG, HA, or GFP-tagged constructs) for immunoprecipitation

    • Validate antibody specificity using TMEM86A knockout controls

    • Perform pull-down experiments followed by mass spectrometry to identify interaction partners

    • Confirm specific interactions with candidate proteins by reciprocal Co-IP

  • Proximity labeling techniques:

    • Develop TMEM86A fusion constructs with BioID or APEX2 enzymes

    • These enzymes biotinylate proteins in close proximity to TMEM86A

    • Isolate biotinylated proteins using streptavidin beads and identify by mass spectrometry

    • This approach is particularly valuable for membrane proteins like TMEM86A

  • Yeast two-hybrid screening:

    • Design bait constructs using soluble domains of TMEM86A

    • Screen against adipocyte, macrophage, or brain cDNA libraries

    • Validate potential interactions using orthogonal methods

  • FRET/BRET approaches:

    • Generate fluorescent protein fusions for TMEM86A and candidate interactors

    • Measure energy transfer as indication of protein proximity

    • Particularly useful for monitoring dynamic interactions in living cells

What is the potential therapeutic relevance of TMEM86A in metabolic diseases?

TMEM86A represents a promising therapeutic target for obesity-related metabolic diseases based on several lines of evidence:

  • Dysregulation in obesity:

    • TMEM86A expression is upregulated in adipose tissue by high-fat diet in mice

    • TMEM86A expression is increased in abdominal subcutaneous white adipose tissue from female patients with obesity manifesting insulin resistance compared to individuals without obesity

  • Protective effects of TMEM86A inhibition:

    • Adipocyte-specific TMEM86A knockout protects mice from high-fat diet-induced metabolic dysfunction

    • This protection is associated with increased energy expenditure and enhanced mitochondrial oxidative metabolism

  • Lysoplasmalogen supplementation as alternative approach:

    • The effects of TMEM86A knockout can be largely reproduced by lysoplasmalogen (LPE P-18:0) supplementation both in vitro and in vivo

    • Treatment with lysoplasmalogen protected mice from HFD-induced metabolic dysfunction

  • Mechanistic rationale:

    • TMEM86A inhibition increases lysoplasmalogen levels, which potentiates PKA signaling through inhibition of PDE3B

    • Enhanced PKA signaling promotes a catabolic phenotype in adipose tissue by regulating lipolysis and mitochondrial function

  • Human relevance:

    • LPE P-18:0 levels are significantly lower in adipose tissue of human patients with obesity

    • This suggests that TMEM86A inhibition or lysoplasmalogen supplementation might have translational potential

What are the most effective experimental approaches for evaluating TMEM86A as a therapeutic target?

Rigorous evaluation of TMEM86A as a therapeutic target requires multifaceted approaches:

  • Pharmacological inhibitor development:

    • Design and screen for small molecule inhibitors targeting TMEM86A lysoplasmalogenase activity

    • Utilize the AlphaFold structural predictions focusing on the catalytic residues D82 and D190

    • Validate inhibitor specificity using enzymatic assays with recombinant TMEM86A

  • Genetic validation in preclinical models:

    • Compare tissue-specific TMEM86A knockout models with inducible/temporal deletion

    • Evaluate effects in established models of obesity, insulin resistance, and diabetes

    • Assess both preventive and therapeutic interventions (deletion before vs. after establishment of disease)

  • Lysoplasmalogen supplementation studies:

    • Determine optimal formulations, dosing, and pharmacokinetics of lysoplasmalogen supplementation

    • Compare different lysoplasmalogen species (e.g., LPE P-18:0 vs. LPC P-18:0)

    • Evaluate potential side effects and toxicity profiles

  • Translational biomarkers:

    • Develop assays to measure lysoplasmalogen levels in human samples (plasma, adipose tissue biopsies)

    • Correlate lysoplasmalogen levels with metabolic parameters in clinical cohorts

    • Identify patient subpopulations most likely to benefit from TMEM86A-targeted interventions

  • Mechanism-based combination approaches:

    • Test TMEM86A inhibition in combination with established metabolic therapies

    • Evaluate synergistic effects with agents targeting complementary pathways

What are common challenges in recombinant TMEM86A expression and purification?

While the search results don't specifically address challenges in TMEM86A expression and purification, these general methodological considerations would apply based on its properties as a multi-pass transmembrane protein:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) may provide proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) often yield higher expression of membrane proteins

    • Bacterial systems may be suitable for isolated domains but challenging for full-length protein

  • Solubilization strategies:

    • Careful selection of detergents is critical (e.g., DDM, LMNG, or digitonin)

    • Detergent screening to identify conditions that maintain enzymatic activity

    • Consider nanodiscs or amphipols for maintaining native-like membrane environment

  • Purification approaches:

    • Affinity tags (His, FLAG, or tandem tags) positioned to avoid interference with transmembrane domains

    • Two-step purification combining affinity chromatography with size exclusion

    • Validate purified protein by confirming enzymatic activity with lysoplasmalogen substrates

  • Quality control:

    • Assess protein homogeneity by size exclusion chromatography

    • Verify proper folding using circular dichroism or limited proteolysis

    • Confirm enzymatic activity using assays described in section 2.4

How can researchers optimize experimental conditions for measuring TMEM86A activity in different cellular contexts?

Optimizing experimental conditions for measuring TMEM86A activity requires attention to several factors:

  • Cell type considerations:

    • Primary adipocytes vs. cell lines (3T3-L1, C3H10T1/2)

    • Macrophages (bone marrow-derived macrophages, RAW264.7)

    • Expression levels of endogenous TMEM86A in different cell types

  • Substrate delivery optimization:

    • Lysoplasmalogen solubility and delivery methods (complexed with BSA vs. direct addition)

    • Concentration ranges that avoid toxicity while providing detectable signal

    • Timing of substrate addition and sample collection

  • Detection method sensitivity:

    • LC-MS methods optimized for specific lysoplasmalogen species

    • Internal standards for quantification

    • Sample preparation to minimize phospholipid degradation during processing

  • Controls and validation:

    • TMEM86A knockout or knockdown cells as negative controls

    • Catalytic mutants (D82A, D190A) to confirm specificity

    • Positive controls with known lysoplasmalogenase activity (e.g., TMEM86B)

  • Assay conditions:

    • Buffer composition, pH optimization

    • Temperature and time course optimization

    • Presence of potential cofactors or inhibitors

What are the critical considerations when analyzing the downstream effects of TMEM86A on intracellular signaling pathways?

Analysis of TMEM86A's effects on signaling pathways requires careful experimental design:

  • PKA signaling assessment:

    • Measure phosphorylation of key PKA substrates (HSL, CREB) by immunoblotting

    • Direct measurement of cAMP levels using enzyme immunoassay or FRET-based sensors

    • Assessment of PDE3B activity to confirm mechanism of cAMP elevation

  • Temporal considerations:

    • Acute vs. chronic effects of TMEM86A manipulation

    • Time-course analyses to distinguish primary from secondary effects

    • Consideration of feedback mechanisms that may dampen initial signaling changes

  • Pathway specificity:

    • Determine whether effects are specific to PKA or extend to other cAMP effectors (EPAC, ion channels)

    • Assess potential cross-talk with other signaling pathways (insulin signaling, AMPK)

    • Use pathway inhibitors to confirm causality in observed phenotypes

  • Tissue and cellular context:

    • Compare signaling effects across different adipose tissue depots (BAT, iWAT, gWAT)

    • Consider cell-type specific responses within heterogeneous tissues

    • Validate in both in vitro and in vivo models

  • Functional readouts:

    • Connect signaling changes to functional outcomes (lipolysis, thermogenesis)

    • Assess mitochondrial respiration using Seahorse analyzer or similar technologies

    • Measure relevant metabolites affected by altered signaling

What are promising avenues for future research on TMEM86A beyond its established role in adipose tissue?

Several promising research directions emerge from current understanding of TMEM86A:

  • Neurological functions:

    • Investigate TMEM86A in brain tissues where plasmalogens are highly abundant

    • Explore potential roles in neurodegenerative disorders where plasmalogen metabolism is dysregulated

    • Examine effects on microglial function, given its expression in these cells

  • Cardiovascular implications:

    • Further characterize TMEM86A in atherosclerotic plaque macrophages

    • Determine its contribution to foam cell formation and plaque stability

    • Evaluate potential as therapeutic target in atherosclerosis

  • Developmental biology:

    • Study role in adipose tissue development and browning

    • Investigate potential functions during embryonic development

    • Examine age-related changes in expression and function

  • Structural biology:

    • Validate and refine the AlphaFold predictions through experimental approaches

    • Conduct mutagenesis studies to fully map the catalytic site beyond D82 and D190

    • Explore potential for structure-based drug design targeting TMEM86A

  • Systems biology:

    • Integrate TMEM86A function into broader networks of lipid metabolism

    • Develop computational models of how lysoplasmalogen metabolism affects membrane properties

    • Explore potential moonlighting functions beyond lysoplasmalogenase activity

How might technological advances improve our understanding of TMEM86A biology?

Emerging technologies offer new opportunities to deepen our understanding of TMEM86A:

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell populations with highest TMEM86A expression

    • Spatial transcriptomics to map expression within tissue architecture

    • CyTOF or imaging mass cytometry to correlate TMEM86A with other proteins at single-cell level

  • Advanced imaging:

    • Super-resolution microscopy to precisely localize TMEM86A within subcellular compartments

    • Live-cell imaging with labeled lysoplasmalogens to visualize substrate processing in real time

    • Correlative light and electron microscopy to connect function with ultrastructure

  • CRISPR technologies:

    • CRISPR activation/inhibition for temporal control of TMEM86A expression

    • Base editing for introducing specific mutations without full gene knockout

    • CRISPR screening to identify genetic modifiers of TMEM86A function

  • Advanced lipidomics:

    • Imaging mass spectrometry to map lysoplasmalogen distribution in tissues

    • Stable isotope tracing to track lysoplasmalogen metabolism kinetics

    • Single-cell lipidomics to capture cellular heterogeneity in lipid composition

  • Computational approaches:

    • Molecular dynamics simulations of TMEM86A within membranes

    • Network analysis integrating transcriptomic, proteomic, and lipidomic data

    • Machine learning to predict phenotypic outcomes of TMEM86A modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.