Recombinant Mouse Lysosomal-associated transmembrane protein 4B (Laptm4b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please communicate your preference. We will prioritize developing the specified tag.
Synonyms
Laptm4b; Lysosomal-associated transmembrane protein 4B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Laptm4b
Target Protein Sequence
MKMVAPWTRFYSHSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPNQYHFSGSEL GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVPSTAKEPPPPYVSA
Uniprot No.

Target Background

Function
LAPTM4B is essential for optimal lysosomal function. It inhibits EGF-stimulated EGFR intraluminal sorting and degradation. Conversely, by binding to phosphatidylinositol 4,5-bisphosphate, it regulates its PIP5K1C interaction, inhibits HGS ubiquitination, and relieves LAPTM4B inhibition of EGFR degradation. It recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, facilitating the entry of leucine and other essential amino acids (EAAs) into the lysosome. This stimulates the activation of the proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and consequently mTORC1 activation. LAPTM4B plays a role as a negative regulator of TGFB1 production in regulatory T cells. It binds ceramide and facilitates its exit from the late endosome to control cell death pathways.
Gene References Into Functions
  1. Research suggests that while some aspects of LAPTM5 lysosomal sorting are conserved among LAPTM4 proteins, LAPTM4a and LAPTM4b have also developed unique sorting requirements. PMID: 22096579
  2. LAPTM4B is a potential proto-oncogene whose overexpression is implicated in carcinogenesis and the progression of hepatocellular carcinoma. PMID: 12902989
Database Links
Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Late endosome membrane. Cell membrane. Cell projection. Lysosome membrane. Endosome membrane. Endosome, multivesicular body membrane. Endosome, multivesicular body lumen.

Q&A

What is mouse Laptm4b and what are its key structural characteristics?

Mouse Laptm4b is a transmembrane protein predominantly localized to lysosomes and endosomes. It contains multiple transmembrane domains and characteristic C-terminal polyproline-tyrosine (PY) motifs that are critical for its function. These PY motifs may target Laptm4b to lysosomes and are potentially involved in the regulation of receptor degradation through lysosomal targeting mechanisms, similar to other LAPTM family members . The protein exists in multiple isoforms, resulting from alternative splicing and different translation start sites, which may contribute to its diverse cellular functions.

How are the different mRNA variants of Laptm4b expressed in mouse tissues?

At least two mRNA variants of Laptm4b have been identified in murine tissues. According to research on human Tregs (which shares homology with mouse variants), these include:

  • Variant a (Va): Expressed in regulatory T cells, this variant lacks exon E1b and uses an alternative start codon. The precise 5' extremity of this variant remains undefined.

  • Variant b (Vb): This variant includes an alternative first exon (E1b) and has been identified through 5' rapid amplification of cDNA ends .

These variants potentially encode proteins with different N-terminal regions, which may affect their localization and function. Researchers investigating mouse Laptm4b should consider these variants when designing primers for gene expression studies.

What are the primary biological functions of Laptm4b in normal mouse physiology?

Laptm4b participates in several critical cellular processes:

What methods are recommended for detecting endogenous Laptm4b expression in mouse tissues?

For comprehensive Laptm4b expression analysis in mouse tissues, researchers should consider a multi-method approach:

  • RT-PCR and qPCR: Design primers specific to the different Laptm4b variants. Based on research findings, sense primers targeting regions upstream of alternative start codons combined with antisense primers from conserved regions can distinguish between variants. For example, in human studies, primers A2 (straddling an alternative start codon) and R amplified a 677 bp product corresponding to variant a, while primers B and R yielded a 608 bp product for variant b .

  • Western blotting: Use antibodies targeting conserved regions of Laptm4b. When analyzing expression patterns, consider that different isoforms (like the 24 kDa and 20 kDa isoforms observed in human cells) may be present in different proportions depending on the tissue type .

  • Immunohistochemistry/Immunofluorescence: For tissue localization studies, validate antibody specificity using Laptm4b-knockout tissues as negative controls.

  • 5' Rapid Amplification of cDNA Ends (5' RACE): This technique is valuable for identifying the precise 5' extremities of different Laptm4b mRNA variants, as demonstrated in previous studies .

How can researchers generate functional recombinant mouse Laptm4b for in vitro studies?

To generate functional recombinant mouse Laptm4b:

  • Expression vector selection: Choose mammalian expression vectors (e.g., pCMV, pCAG) for proper post-translational modifications. Include epitope tags (FLAG, HA, or His) at the C-terminus to avoid interfering with N-terminal targeting sequences.

  • Expression system recommendations:

    • For protein-protein interaction studies: HEK293T cells provide high transfection efficiency and protein yields .

    • For functional studies: Consider cell lines relevant to the biological context being studied (e.g., immune cells for TGF-β studies, cardiomyocytes for autophagy studies).

  • Purification strategy: For membrane proteins like Laptm4b, use detergent-based extraction followed by affinity chromatography targeting the epitope tag.

  • Validation methods:

    • Verify expression by Western blot

    • Confirm subcellular localization by immunofluorescence (primarily lysosomal/endosomal)

    • Validate functionality through known interaction partners (e.g., GARP or mTOR) using co-immunoprecipitation .

What are effective approaches for modulating Laptm4b expression in experimental models?

Several approaches can be used to manipulate Laptm4b expression levels:

  • Knockout models:

    • CRISPR/Cas9 system targeting conserved exons of Laptm4b

    • Conditional knockout using Cre-loxP system for tissue-specific deletion

  • Knockdown strategies:

    • siRNA transfection for transient knockdown

    • shRNA for stable knockdown via lentiviral vectors

  • Overexpression methods:

    • Transient transfection with expression vectors containing Laptm4b cDNA

    • Stable cell lines using antibiotic selection

    • Adeno-associated virus (AAV) delivery for in vivo overexpression, shown to be effective in cardiac models

  • Rescue experiments:

    • Reintroduce wild-type or mutant Laptm4b in knockout models to confirm specificity

    • Use domain-specific mutants (e.g., EC3 domain mutants) to study structure-function relationships

When designing these experiments, consider potential compensatory mechanisms by other LAPTM family members and validate the efficiency of your approach through both mRNA and protein expression analysis.

How does Laptm4b modulate immune function through TGF-β1 signaling?

Laptm4b plays a significant regulatory role in immune function through its effects on TGF-β1 production and signaling, particularly in regulatory T cells (Tregs):

  • Mechanism of TGF-β1 regulation:

    • Laptm4b interacts directly with glycoprotein A repetitions predominant (GARP), a transmembrane protein specifically expressed on stimulated Tregs .

    • This interaction decreases the cleavage of proTGF-β1 into latent TGF-β1, reducing both the secretion of soluble latent TGF-β1 and the surface presentation of GARP·TGF-β1 complexes .

    • Consequently, Laptm4b functions as a negative regulator of TGF-β1 production in Tregs.

  • Functional consequences:

    • By inhibiting TGF-β1 production, Laptm4b decreases the immunosuppressive capacity of Tregs.

    • This modulation may represent an important regulatory mechanism for balancing immune responses, preventing excessive immunosuppression .

  • Potential experimental approach for studying this interaction:

    • Co-immunoprecipitation assays to confirm Laptm4b-GARP interaction

    • Western blot analysis to assess proTGF-β1 cleavage in the presence/absence of Laptm4b

    • Flow cytometry to measure surface levels of GARP and GARP·TGF-β1 complexes

    • Luciferase reporter assays using CAGA-LUC reporter system to analyze TGF-β1 signaling activity

What experimental systems are most appropriate for studying Laptm4b in immune cells?

For investigating Laptm4b function in immune contexts, consider these experimental systems:

  • Cell culture models:

    • Primary mouse Tregs isolated by CD4+CD25+ selection

    • T cell hybridoma lines for stable expression studies

    • 293T cells for reconstitution experiments with GARP and TGF-β1

  • Analysis techniques:

    • Yeast two-hybrid assays to identify novel interaction partners (previously used to discover Laptm4b-GARP interaction)

    • Flow cytometry to assess surface protein expression

    • Cytokine secretion assays to measure TGF-β1 production

    • T cell suppression assays to evaluate functional consequences

  • In vivo models:

    • Conditional Laptm4b knockout in Tregs (using Foxp3-Cre)

    • Adoptive transfer of Laptm4b-modified Tregs

    • Autoimmune disease models to assess functional impact

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with domain-specific mutants

    • Proximity ligation assays for in situ interaction detection

    • FRET/BRET to study dynamic interactions in living cells

How can researchers reconcile contradictory findings about Laptm4b's immune functions?

When encountering contradictory findings regarding Laptm4b's immune functions, consider these methodological approaches:

  • Isoform-specific effects:

    • Determine which Laptm4b isoform was studied (e.g., 24 kDa vs. 20 kDa in human studies)

    • Use isoform-specific constructs to compare functional differences

    • Design experiments that specifically distinguish between variants a and b

  • Context-dependent regulation:

    • Compare Laptm4b function across different immune cell types

    • Assess the influence of activation state on Laptm4b function

    • Examine how different cytokine environments affect Laptm4b activity

  • Interaction with different partners:

    • Perform comprehensive interactome analysis in different cell types

    • Investigate whether GARP expression levels affect Laptm4b function

    • Consider interactions with other lysosomal proteins that may modify Laptm4b activity

  • Experimental design considerations:

    • Control for Laptm4b expression levels (overexpression vs. physiological)

    • Verify subcellular localization in each experimental system

    • Use multiple approaches to confirm findings (e.g., both in vitro and in vivo models)

What role does Laptm4b play in myocardial ischemia/reperfusion injury?

Laptm4b serves a protective function in myocardial ischemia/reperfusion (I/R) injury through its effects on autophagic flux:

  • Expression pattern during I/R:

    • Laptm4b protein is significantly downregulated in I/R hearts and hypoxia/reoxygenation-treated cardiomyocytes .

    • This downregulation appears to be a pathological response that contributes to I/R injury.

  • Functional impact:

    • Loss of Laptm4b aggravates myocardial I/R injury

    • Overexpression of Laptm4b protects the heart from I/R damage

    • These effects operate through modulation of autophagic flux

  • Molecular mechanism:

    • Laptm4b promotes autophagic flux by restoring I/R-impaired autophagosome clearance

    • It interacts with mTOR through its EC3 (extracellular) domain, suppressing mTORC1 activation

    • This suppression maintains TFEB (transcription factor EB) activity, which promotes autophagic flux in cardiomyocytes

  • Experimental evidence:

    • In vivo studies using gain- and loss-of-function approaches in mouse I/R models

    • In vitro confirmation in hypoxia/reoxygenation cardiomyocyte models

    • Mechanistic validation through mTORC1 signaling and TFEB activity assays

How can researchers effectively study Laptm4b's role in autophagic flux in cardiomyocytes?

To investigate Laptm4b's function in cardiomyocyte autophagic flux, consider these methodological approaches:

  • Autophagic flux assessment tools:

    • Tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish between autophagosomes and autolysosomes

    • Western blot analysis of LC3-II and p62/SQSTM1 levels with and without lysosomal inhibitors

    • Transmission electron microscopy to directly visualize autophagic structures

  • Experimental models:

    • Primary mouse cardiomyocytes with Laptm4b overexpression or knockdown

    • H9c2 cardiomyoblast cell line for preliminary studies

    • Hypoxia/reoxygenation protocols to simulate I/R conditions in vitro

    • In vivo mouse models of myocardial I/R with cardiac-specific Laptm4b manipulation

  • Signaling pathway analysis:

    • mTORC1 activity assessment (phosphorylation of S6K, 4E-BP1)

    • TFEB nuclear translocation via immunofluorescence

    • Chromatin immunoprecipitation to assess TFEB binding to lysosomal gene promoters

  • Functional readouts:

    • Cell viability assays under stress conditions

    • Measurements of lysosomal function (pH, enzyme activity)

    • Assessment of mitochondrial quality control

    • Cardiac function parameters in animal models (echocardiography)

What is the relationship between Laptm4b, mTORC1, and TFEB in regulating autophagic flux?

The relationship between Laptm4b, mTORC1, and TFEB forms a regulatory axis critical for autophagic flux:

  • Molecular interaction framework:

    • Laptm4b interacts directly with mTOR through its EC3 domain

    • This interaction suppresses mTORC1 activation

    • When mTORC1 activity is reduced, TFEB remains dephosphorylated

    • Dephosphorylated TFEB translocates to the nucleus and activates genes involved in autophagy and lysosomal biogenesis

  • Functional consequences in I/R:

    • During I/R, Laptm4b is downregulated, removing its inhibitory effect on mTORC1

    • Uninhibited mTORC1 phosphorylates and inactivates TFEB

    • This leads to impaired autophagic flux and lysosomal function

    • Impaired autophagy contributes to increased cardiomyocyte death during I/R

  • Experimental approaches to study this axis:

    • Co-immunoprecipitation to confirm Laptm4b-mTOR interaction

    • Domain mapping to identify critical regions for interaction

    • Phosphorylation analysis of mTORC1 substrates in response to Laptm4b manipulation

    • TFEB subcellular localization and transcriptional activity assays

    • Rescue experiments using mTORC1 inhibitors (e.g., rapamycin) in Laptm4b-depleted cells

  • Regulatory schema:

    ConditionLaptm4b LevelmTORC1 ActivityTFEB LocationAutophagic FluxOutcome in I/R
    NormalMaintainedModerateNuclear/CytoplasmicMaintainedN/A
    I/RDecreasedIncreasedPredominantly CytoplasmicImpairedIncreased injury
    Laptm4b OverexpressionIncreasedSuppressedPredominantly NuclearEnhancedCardioprotection

How does Laptm4b influence ferroptosis in cancer cells?

Laptm4b plays a crucial protective role against ferroptosis in cancer cells:

  • Anti-ferroptotic mechanism:

    • Laptm4b inhibits NEDD4L/ZRANB1-mediated ubiquitination of SLC7A11 (cystine-glutamate antiporter)

    • This inhibition prevents the proteasomal degradation of SLC7A11

    • Stabilized SLC7A11 enhances cystine uptake, supporting glutathione synthesis

    • Increased glutathione protects against lipid peroxidation and ferroptosis

  • Experimental evidence:

    • Laptm4b knockout sensitizes cancer cells to erastin-induced ferroptosis both in vitro and in vivo

    • Metabolomic profiling revealed significant enrichment of ferroptosis-associated metabolic alterations in Laptm4b knockout cells

    • Correlation between Laptm4b and SLC7A11 expression in tissue samples from nude mice and NSCLC patients

  • Clinical implications:

    • High expression of both Laptm4b and SLC7A11 is associated with poor prognosis in NSCLC patients

    • Analysis of The Cancer Genome Atlas (TCGA) data supports this correlation

    • These findings suggest Laptm4b as a potential therapeutic target for inducing ferroptosis in cancer cells

What metabolic processes are regulated by Laptm4b in cancer cells?

Laptm4b influences several key metabolic pathways in cancer cells:

  • Amino acid metabolism:

    • By stabilizing SLC7A11, Laptm4b enhances cystine uptake

    • This supports glutathione synthesis and cysteine-dependent metabolic processes

  • Lipid metabolism:

    • Laptm4b is co-amplified with the lipid transport-related gene NDRG1 in breast cancer patients

    • Laptm4b knockout leads to metabolic alterations associated with lipid peroxidation

    • These findings suggest a role in regulating lipid homeostasis

  • Redox balance:

    • Through its effects on glutathione synthesis, Laptm4b helps maintain cellular redox homeostasis

    • This function is particularly important under oxidative stress conditions common in tumor microenvironments

  • Autophagic metabolism:

    • Similar to its role in cardiomyocytes, Laptm4b likely influences autophagic flux in cancer cells

    • Autophagy regulation affects cellular metabolism through recycling of macromolecules

A metabolomic analysis approach for studying Laptm4b's metabolic effects should include:

  • Untargeted metabolomics to identify broadly affected pathways

  • Targeted analysis of glutathione-related metabolites

  • Stable isotope tracing to track cystine utilization

  • Lipidomic profiling to assess effects on lipid composition and peroxidation

What experimental approaches can be used to study the interaction between Laptm4b and SLC7A11?

To investigate the Laptm4b-SLC7A11 regulatory relationship:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation to detect interactions between Laptm4b, SLC7A11, NEDD4L, and ZRANB1

    • Proximity ligation assay for in situ visualization of interactions

    • FRET/BRET approaches for real-time interaction dynamics

  • Ubiquitination assays:

    • In vivo ubiquitination assays with HA-tagged ubiquitin

    • In vitro reconstitution with purified components

    • Ubiquitin chain linkage analysis to determine degradation mechanism

  • Functional studies:

    • Cystine uptake assays using 14C-labeled cystine

    • Glutathione measurement using enzymatic or fluorescent approaches

    • Ferroptosis induction with erastin or RSL3, quantified by cell viability and lipid peroxidation

  • Structure-function analysis:

    • Domain mapping to identify regions required for SLC7A11 protection

    • Mutagenesis of key residues in Laptm4b

    • Chimeric protein analysis with other LAPTM family members

  • In vivo validation:

    • Xenograft models with Laptm4b-manipulated cancer cells

    • Treatment with ferroptosis inducers

    • Correlation analysis in patient samples for Laptm4b and SLC7A11 expression

    • Immunohistochemistry to assess co-localization in tumor tissues

How do the different isoforms of Laptm4b affect its function across various tissues?

The functional diversity of Laptm4b isoforms presents important research considerations:

What are emerging areas of Laptm4b research beyond current applications?

Emerging research directions for Laptm4b include:

  • Metabolic regulation beyond cancer:

    • Potential roles in normal metabolic processes in non-transformed cells

    • Investigation of Laptm4b in metabolic disorders and metabolic stress responses

  • Expanded immune functions:

    • Roles in immune cells beyond Tregs

    • Potential involvement in antigen presentation pathways

    • Functions in innate immune responses

  • Lysosomal quality control:

    • Contribution to lysosomal membrane integrity under stress conditions

    • Potential roles in lysosomal storage disorders

    • Interaction with the lysosomal nutrient sensing machinery

  • Developmental biology:

    • Roles in embryonic development and tissue differentiation

    • Expression patterns during critical developmental windows

    • Potential functions in stem cell maintenance or differentiation

  • Therapeutic targeting strategies:

    • Development of specific Laptm4b inhibitors for cancer therapy

    • Approaches to enhance Laptm4b function for cardioprotection

    • Isoform-specific targeting strategies

How can contradictory findings about Laptm4b function be reconciled through experimental design?

To address contradictions in Laptm4b research:

  • Context-dependent functions:

    • Systematically compare Laptm4b function across different cell types using identical methodologies

    • Investigate how cellular stress conditions modify Laptm4b activity

    • Consider microenvironmental factors that may influence Laptm4b function

  • Methodological standardization:

    • Develop consensus protocols for Laptm4b detection and functional assays

    • Create repositories of validated reagents (antibodies, expression constructs)

    • Establish reporter systems for monitoring Laptm4b-dependent processes

  • Comprehensive structure-function analysis:

    • Generate a panel of domain-specific mutants

    • Map interaction interfaces with key partners (GARP, mTOR, SLC7A11)

    • Determine post-translational modifications that affect function

  • Systems biology approaches:

    • Perform multi-omics analyses (transcriptomics, proteomics, metabolomics) in Laptm4b-manipulated systems

    • Develop computational models of Laptm4b regulatory networks

    • Use machine learning to identify patterns in seemingly contradictory datasets

  • Multi-laboratory validation:

    • Establish collaborative networks for independent verification of key findings

    • Use identical biological materials across laboratories

    • Implement blinded analysis procedures to minimize bias

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.