Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5)

Shipped with Ice Packs
In Stock

Description

Lysosomal Regulation

  • Recruits E3 ubiquitin ligase WWP2 to promote ubiquitination and lysosomal degradation of BMP receptor BMPR1A, disrupting BMP signaling and enhancing cancer stem cell self-renewal in lung metastases .

  • Maintains lysosomal stability; its overexpression induces lysosomal cell death (LCD), while its deficiency disrupts lysosomal integrity .

Autophagy and Apoptosis

  • Modulates autophagy during disease progression. In cerebral ischemia-reperfusion (I/R) injury, LAPTM5 deficiency exacerbates neuronal apoptosis by activating the ASK1-JNK/p38 pathway .

  • In B cells, LAPTM5 promotes apoptosis of autoreactive immature B cells by upregulating pro-apoptotic BIM, preventing autoantibody production .

Cancer Metastasis

ModelKey FindingsReference
Renal cell carcinomaLAPTM5 overexpression enhances lung-specific metastasis by degrading BMPR1A.
Human RCC cell linesLAPTM5 knockdown reduces lung metastasis in vivo.

Autoimmunity

  • Laptm5 knockout mice exhibit increased IgM anti-DNA autoantibodies and expanded marginal zone B cells, linking LAPTM5 deficiency to autoimmune responses .

Cardiovascular and Cerebral Diseases

  • In neonatal rat cardiomyocytes, LAPTM5 knockdown exacerbates angiotensin II-induced hypertrophy, suggesting cardioprotective roles .

  • Cerebral I/R injury models show LAPTM5 deficiency aggravates inflammation and apoptosis via NF-κB and ASK1 pathways .

Cancer

  • Targeting LAPTM5-WWP2-BMPR1A axis may inhibit lung metastasis in renal and other cancers .

  • Lysosomal inhibitors like chloroquine restore BMPR1A levels, countering LAPTM5-mediated degradation .

Neuroprotection

  • LAPTM5 overexpression in neurons reduces post-ischemic inflammation (e.g., TNF-α, CCL2) and apoptosis (e.g., Bax, Caspase-3) .

Research Applications of Recombinant LAPTM5

  • Gene Editing: Used in CRISPR/Cas9 models (e.g., Laptm5 knockout mice) to study autoimmune and metastatic mechanisms .

  • Functional Studies: Overexpression/knockdown in cell lines (e.g., Renca, 786O) to validate metastasis or apoptosis pathways .

  • Therapeutic Screening: Testing lysosomal inhibitors or BMP agonists to counteract LAPTM5 effects in preclinical models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your reconstitution.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Laptm5; Lysosomal-associated transmembrane protein 5; Lysosomal-associated multitransmembrane protein 5; Retinoic acid-inducible E3 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Laptm5
Target Protein Sequence
MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRM ADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY LKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPH SQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE ALSLPPKTPEGDPAPPPYSEV
Uniprot No.

Target Background

Function
Lysosomal-associated transmembrane protein 5 (LAPTM5) may play a critical role during embryogenesis and in adult hematopoietic cells.
Gene References Into Functions
  1. Research indicates that CD3zeta can be degraded through two pathways: SLAP/c-Cbl, which targets internalized cell surface CD3zeta dependent on TCR signaling, and LAPTM5, which targets intracellular CD3zeta independent of TCR signaling. PMID: 24638062
  2. The pre-BCR induces downregulation of its own expression through induction of LAPTM5, which facilitates lysosomal transport and degradation of the intracellular pre-BCR pool, limiting its supply to the cell surface. PMID: 22949502
  3. LAPTM5 acts as a positive modulator of inflammatory signaling pathways and subsequent cytokine secretion in macrophages. PMID: 22733818
  4. LAPTM5 physically interacts with the B cell receptor complex and promotes its degradation in the lysosomal compartment in mouse B cells. PMID: 20519653
  5. The lysosomal protein LAPTM5 negatively regulates surface TCR expression by specifically interacting with the invariant signal-transducing CD3zeta chain and promoting its degradation. PMID: 18619870

Show More

Hide All

Database Links
Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues.

Q&A

What is mouse Laptm5 and what are its structural and functional characteristics?

Laptm5 (Lysosomal-associated protein multispanning transmembrane 5) is a transmembrane protein primarily localized to lysosomes. It functions through protein-protein interactions that influence degradation pathways. In mouse models, Laptm5 has been shown to regulate protein degradation via the lysosomal pathway, particularly targeting the E3 ubiquitin ligase WWP2 for lysosomal degradation . This results in the accumulation of WWP2's substrate PTEN and subsequently decreases AKT phosphorylation in B cells.

Structurally, Laptm5 is a multi-spanning transmembrane protein that can accumulate in cells when either proteasomal or lysosomal degradation systems are inhibited with compounds such as ALLN, MG132 (proteasomal inhibitors), or Bafilomycin A1 and NH₄Cl (lysosomal inhibitors) .

How is Laptm5 expression regulated in different tissues and cell types?

Laptm5 expression varies across tissues and can be regulated through epigenetic mechanisms. In neuroblastoma cells, Laptm5 is frequently down-regulated through DNA methylation . In studies of B cells, Laptm5 expression has been found to be crucial for normal B cell development and tolerance mechanisms .

The expression pattern of Laptm5 can also be context-dependent. For instance, it is up-regulated in degenerating neuroblastoma cells within locally regressing tumor areas, despite being generally down-regulated in most neuroblastoma samples . This suggests that Laptm5 expression can be dynamically regulated during disease progression or regression.

For research purposes, monitoring Laptm5 expression levels via qPCR, western blotting, or immunofluorescence in different tissues is recommended to establish baseline expression profiles before experimental manipulation.

What mouse models are available to study Laptm5 function?

Several mouse models have been developed to study Laptm5 function, including:

  • Laptm5⁻/⁻ knockout mice: These mice show altered B cell development and increased susceptibility to autoimmunity .

  • Laptm5⁻/⁻56R mice: Generated by crossing Laptm5⁻/⁻ mice with 56R heavy chain (HC) knockin mice, which allows for studying the role of Laptm5 in eliminating autoreactive B cells .

The 56R HC knockin model is particularly useful as it produces autoreactive B cells that recognize DNA, allowing researchers to study tolerance mechanisms. The comparison between 56R and Laptm5⁻/⁻56R mice has revealed that Laptm5 plays a significant role in eliminating autoreactive immature B cells in the bone marrow and limiting the development of low-avidity autoreactive B cells into marginal zone B cells .

What are the molecular mechanisms through which Laptm5 mediates B cell apoptosis?

Laptm5 mediates B cell apoptosis through a specific molecular cascade involving WWP2 and PTEN. Based on detailed molecular and proteomics analyses, Laptm5 targets the E3 ubiquitin ligase WWP2 for lysosomal degradation . This degradation results in:

  • Accumulation of WWP2's substrate PTEN

  • Decreased AKT phosphorylation

  • Altered cell survival signaling pathways

This LAPTM5-WWP2-PTEN cascade is crucial for regulating immature B cell apoptosis and contributes to B cell tolerance. Quantitative set analysis for gene expression (QuSAGE) has revealed that immature B cells from Laptm5⁻/⁻56R mice are enriched in PI3K-Akt, mTOR, Ras, and MAPK signaling pathways that contribute to cell survival, which explains the decreased cell death observed in these cells compared to immature B cells from 56R mice .

The effect of Laptm5 deficiency resembles that observed in BIM-deficient mice, suggesting that Laptm5 contributes to B cell tolerance by up-regulating BIM, a pro-apoptotic protein . This mechanism represents a previously unidentified pathway that regulates immature B cell apoptosis.

How does Laptm5 contribute to B cell tolerance and prevention of autoimmunity?

Laptm5 plays a critical role in B cell tolerance through multiple mechanisms:

  • Elimination of autoreactive immature B cells: In normal conditions, Laptm5 facilitates the elimination of autoreactive immature B cells in the bone marrow. Studies with Laptm5⁻/⁻56R mice show increased proportions of immature B and mature B cells compared to 56R mice, indicating that Laptm5 deficiency allows more autoreactive B cells to survive .

  • Regulation of marginal zone B cell development: Laptm5 limits the ability of low-avidity autoreactive B cells to become marginal zone B (MZB) cells. Laptm5⁻/⁻56R mice contain significantly higher percentages of Vκ38C⁺ MZBs (which have low-avidity DNA binding) compared to 56R mice .

  • Prevention of autoantibody production: The increased Vκ38C⁺ MZB cells in Laptm5⁻/⁻56R mice correlate with increased production of IgM anti-DNA and IgM anti-nuclear antibodies. This demonstrates that Laptm5 helps prevent autoimmunity by limiting the development of autoreactive B cells that can produce autoantibodies .

This connection to autoimmunity is further supported by gene expression analyses showing that mature B cells from Laptm5⁻/⁻56R mice are enriched for activated autoimmune disease and transplant rejection pathways compared to those from 56R mice .

What role does Laptm5 play in cancer progression and metastasis?

Laptm5 has dual and context-dependent roles in cancer:

The mechanism in renal cancer involves Laptm5 recruiting WWP2, which binds to the BMP receptor BMPR1A and mediates its lysosomal sorting, ubiquitination, and degradation. This process can be inhibited by the lysosomal inhibitor chloroquine. Importantly, Laptm5 expression serves as an independent predictor of lung metastasis in renal cancer .

The elevation of Laptm5 expression in lung metastases appears to be a common phenomenon across multiple cancer types, suggesting a broader role in metastatic processes .

What are the recommended protocols for studying Laptm5-mediated cell death mechanisms?

When studying Laptm5-mediated cell death mechanisms, several approaches have proven effective:

  • Overexpression systems: Use adenoviral vectors (Ad-LAPTM5) to overexpress Laptm5 in target cells. This approach was used successfully in GOTO neuroblastoma cells to induce cell death .

  • Protein accumulation assessment: Since Laptm5-induced cell death requires protein accumulation, researchers should monitor protein levels over time post-infection or post-transfection. Significant cell death typically manifests around 48 hours after infection in neuroblastoma models .

  • Inhibitor studies: Treatment with proteasomal inhibitors (ALLN, MG132) or lysosomal inhibitors (Bafilomycin A1, NH₄Cl) can enhance Laptm5 accumulation and accelerate cell death mechanisms .

  • Cell death characterization: Laptm5-mediated cell death should be characterized by:

    • Assessment of autophagic vacuole formation

    • Evaluation of lysosomal membrane permeabilization (LMP)

    • Analysis of caspase independence

    • Monitoring of p62/SQSTM1 and ubiquitinated protein accumulation

This methodological approach allows researchers to distinguish Laptm5-induced lysosomal cell death with impaired autophagy from other forms of programmed cell death.

How can recombinant mouse Laptm5 be utilized to study B cell selection and tolerance?

To study B cell selection and tolerance using recombinant mouse Laptm5, researchers should consider these methodological approaches:

  • Comparative analysis using genetic models: Compare B cell development, selection, and autoimmunity in:

    • Wild-type mice

    • Laptm5⁻/⁻ knockout mice

    • 56R HC knockin mice (autoreactive model)

    • Laptm5⁻/⁻56R double mutant mice

  • Immature B cell analysis: Focus on bone marrow immature B cell populations (B220⁺IgM⁺) to evaluate the impact of Laptm5 on selection against autoreactive specificities. Flow cytometry analysis should track changes in population percentages and absolute numbers .

  • Light chain repertoire assessment: Employ single-cell BCR sequencing (scBCR-Seq) to analyze the light chain repertoire diversity. This technique revealed that Laptm5⁻/⁻56R mice had increased usage of the 56R heavy chain (IGHV1-82) compared to 56R mice .

  • Marginal zone B cell analysis: Assess the proportion of Vκ38C⁺ and Vκ21D⁺ cells within the marginal zone B cell compartment, as these represent different levels of self-reactivity .

  • Autoantibody measurement: Quantify anti-DNA and anti-nuclear antibodies (particularly IgM isotype) in serum samples to correlate Laptm5 function with autoimmunity development .

What experimental approaches can be used to investigate Laptm5's role in protein trafficking and degradation?

To study Laptm5's role in protein trafficking and degradation, researchers should consider these experimental approaches:

  • Protein degradation pathway inhibition: Use specific inhibitors to block different degradation pathways:

    • Proteasome inhibitors: ALLN, MG132

    • Lysosome inhibitors: Bafilomycin A1, NH₄Cl, Chloroquine

    • Compare the effects on Laptm5 target proteins under these conditions

  • Co-immunoprecipitation assays: Identify Laptm5 interaction partners such as WWP2. This approach helped establish that Laptm5 recruits WWP2 to mediate BMPR1A degradation in renal cancer cells .

  • Ubiquitination assays: Assess the ubiquitination status of putative Laptm5 targets (like BMPR1A or WWP2) in the presence or absence of Laptm5 .

  • Lysosomal sorting visualization: Use fluorescence microscopy with markers for lysosomes (LAMP1/2) and target proteins to visualize the trafficking of Laptm5-regulated proteins to lysosomes.

  • Degradation kinetics: Perform pulse-chase experiments to measure the half-life of target proteins in the presence or absence of functional Laptm5.

What are the latest findings regarding the Laptm5-WWP2-PTEN signaling axis?

Recent research has uncovered a previously unidentified Laptm5-WWP2-PTEN cascade that regulates immature B cell apoptosis and contributes to B cell tolerance . Key findings include:

  • Laptm5 targets the E3 ubiquitin ligase WWP2 for lysosomal degradation.

  • This degradation results in the accumulation of WWP2's substrate PTEN.

  • Increased PTEN levels lead to decreased AKT phosphorylation, affecting cell survival pathways.

  • In Laptm5⁻/⁻56R mice, immature B cells show enrichment in PI3K-Akt, mTOR, Ras, and MAPK signaling pathways that promote cell survival.

  • The molecular mechanism resembles that observed in BIM-deficient mice, suggesting Laptm5 contributes to B cell tolerance by up-regulating the pro-apoptotic protein BIM.

This signaling axis represents a novel mechanistic understanding of how Laptm5 mediates cell death and provides potential therapeutic targets for autoimmune disorders involving B cell dysregulation .

How does Laptm5 influence autophagy and lysosomal function?

Recent studies have revealed complex interactions between Laptm5, autophagy, and lysosomal function:

  • Disruption of autophagic flux: Laptm5-mediated lysosomal destabilization with lysosomal-membrane permeabilization (LMP) leads to an interruption of autophagic flux in neuroblastoma cells .

  • Accumulation of autophagic markers: This interruption results in the accumulation of:

    • Immature autophagic vacuoles

    • p62/SQSTM1 (autophagy receptor)

    • Ubiquitinated proteins that would normally be degraded through autophagy

  • Formation of inclusion bodies: Ubiquitin-positive inclusion bodies appear in degenerating neuroblastoma cells following Laptm5 overexpression .

  • Lysosomal degradation targeting: In renal cancer cells, Laptm5 specifically targets the BMP receptor BMPR1A for lysosomal degradation by recruiting WWP2 .

The current understanding suggests that Laptm5-induced cell death is not classic autophagic cell death but rather lysosomal cell death with impaired autophagy. This mechanism appears particularly important in the spontaneous regression of neuroblastomas and opens new avenues for therapeutic interventions targeting lysosomes and autophagy in cancer .

Comparative analysis of B cell populations in different mouse models

Mouse ModelImmature B Cells (%)Mature B Cells (%)Vκ38C⁺ MZB Cells (%)IgM Anti-DNA Antibodies
Wild-typeBaselineBaselineBaselineLow
Laptm5⁻/⁻IncreasedIncreasedIncreasedElevated
56RReducedReducedModerateModerate
Laptm5⁻/⁻56RHigher than 56RHigher than 56RSignificantly higher than 56RHigher than 56R

Note: This table summarizes the relative changes in B cell populations and autoantibody production across different mouse models based on findings from references and .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.