Recombinant Mouse Magnesium transporter protein 1 (Magt1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please communicate it to us, and we will prioritize developing it for your order.
Synonyms
Magt1; Iag2; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-335
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Magt1
Target Protein Sequence
QRKKEMVLSEKVSQLMEWANKRPVIRMNGDKFRRLVKAPPRNYSVVVMFTALQLHRQCVV CKQADEEFQILANSWRYSNAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAATSDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS
Uniprot No.

Target Background

Function
Magt1 acts as an accessory component of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. It plays a role in N-glycosylation of STT3B-dependent substrates. Magt1 is specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues, functioning redundantly with TUSC3 in this process. In its oxidized form, Magt1 is thought to form transient mixed disulfides with a glycoprotein substrate, facilitating access of STT3B to the unmodified acceptor site. Magt1 also has oxidoreductase-independent functions within the STT3B-containing OST complex, potentially involving substrate recognition. Additionally, it may be involved in Mg(2+) transport in epithelial cells.
Database Links
Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in kidney, colon, heart and liver. Expressed at lower levels in intestine, spleen, brain and lung.

Q&A

What is Magnesium transporter protein 1 (Magt1) and what are its primary functions?

Magt1 is an evolutionarily conserved Mg²⁺-specific ion transport facilitator found in all animals. Research has revealed its dual functionality: (1) as a magnesium transporter regulating basal intracellular Mg²⁺ concentration, particularly in T lymphocytes, and (2) as an integral component of the oligosaccharyltransferase (OST) complex involved in N-linked glycosylation. Magt1 specifically associates with the STT3B catalytic subunit of the OST complex, where it contributes to proper glycosylation of STT3B substrates through its oxidoreductase activity . The protein plays critical roles in both immune function and developmental processes through these mechanisms.

How does Magt1 localize within mammalian cells and what does this reveal about its function?

Subcellular localization studies using gradient fractionation assays with T-cell lines have demonstrated that Magt1 predominantly localizes to the endoplasmic reticulum (ER), trans-Golgi, and plasma membrane fractions . This distribution pattern supports its dual functionality. Proximity ligation assays (PLA) have confirmed robust association of Magt1 with several members of the OST complex localized in the ER, including ribophorin I, OST48, and STT3B . This methodology requires both proteins to be in close proximity (30-40nm) to generate a punctate co-localization signal detectable by confocal microscopy. The ER localization correlates with its role in protein glycosylation, while plasma membrane presence supports its function in magnesium transport. This distribution pattern is essential to consider when designing experiments targeting specific Magt1 functions.

What are the optimal cell models for studying Magt1 function and which specific assays should be employed?

Based on comparative analyses of different cell types, EBV-transformed lymphocytes represent the ideal patient-derived cellular model for assessing Magt1 mutations and function . This is because lymphocytes do not express the compensatory homolog TUSC3, allowing for clearer assessment of Magt1-specific effects. For comprehensive functional studies, researchers should employ:

Cell TypeAdvantagesLimitationsRecommended Assays
EBV-transformed lymphocytesNo TUSC3 compensation; pronounced glycosylation defectsLimited to immune function studiesGlycan incorporation assays; STT3B substrate processing
FibroblastsEasy to culture; allows TUSC3 compensation studyMild glycosylation phenotype due to TUSC3SHBG reporter assays; X-inactivation assays
HEK293 MAGT1⁻/⁻TUSC3⁻/⁻ cellsClean background for reconstitution studiesArtificial systemPulse-chase glycan labeling; complementation assays
Primary mouse plateletsIn vivo relevance for thrombosis studiesSpecies differencesCalcium flux assays; aggregation assays

For glycosylation assessment, pulse-chase radiolabeling with SHBG, pCatC, and pSap reporter proteins has proven effective in distinguishing STT3A versus STT3B substrate processing . For magnesium transport function, direct Mg²⁺ measurements and downstream signaling assessments in immune cells provide the most reliable data.

How should researchers design genetic models for studying Magt1 deficiency?

When designing genetic models to study Magt1 deficiency, researchers must consider several critical factors. First, since Magt1 is X-linked, male models (Magt1⁻/ʸ) provide complete deficiency, while female models require X-inactivation analysis. Studies have employed X-inactivation assays using the androgen receptor to determine X-inactivation ratios in human samples, revealing skewed X-inactivation (98-100%) in maternal carriers .

For cellular models, CRISPR/Cas9 knockout systems have been successfully employed to generate both single (Magt1⁻/⁻) and double (Magt1⁻/⁻TUSC3⁻/⁻) knockout lines . The double knockout approach is particularly valuable as it eliminates compensatory effects from TUSC3. For mutagenesis studies, researchers should use site-directed mutagenesis to introduce patient-specific mutations (e.g., p.Lys356Asn, p.Arg331*, p.Leu313*) into expression vectors containing the wild-type Magt1 coding sequence, followed by functional complementation assays in knockout backgrounds .

For in vivo models, Magt1⁻/ʸ mice have demonstrated accelerated arterial thrombus formation, shortened bleeding time, and increased susceptibility to ischemic brain damage, making them valuable for studying cardiovascular and neurological aspects of Magt1 function .

What methodologies are most effective for assessing Magt1-dependent glycosylation in experimental systems?

Assessment of Magt1-dependent glycosylation requires specific methodologies targeting STT3B-dependent substrates. The following approaches have proven most effective:

  • Pulse-chase radiolabeling: Using reporter proteins like sex hormone-binding globulin (SHBG), researchers can quantify glycan incorporation over time. Studies show a reduction of 70% in average glycan number on SHBG in Magt1⁻/⁻TUSC3⁻/⁻ cells compared to wild-type cells .

  • Western blot mobility shift assays: Analyzing the electrophoretic mobility of known STT3B substrates such as pro-cathepsin C (pCatC) and glucose transporter 1 (GLUT1) can reveal hypoglycosylation. These proteins show distinct mobility shifts in patient-derived cells with Magt1 mutations .

  • Substrate specificity controls: Always include STT3A-specific substrates (such as prosaposin/pSap) as negative controls to confirm STT3B-specific effects of Magt1 deficiency .

  • Complementation assays: Expressing wild-type or mutant Magt1 in knockout backgrounds to assess rescue of glycosylation defects. This approach has confirmed that patient mutations fail to restore normal glycosylation of reporter proteins .

  • Serum transferrin analyses: Isoelectric focusing of serum transferrin provides a clinical biomarker for Magt1-associated glycosylation disorders, with patients showing characteristic type 1 patterns with elevated 2-sialo forms (5.0-7.0%, normal range: 0-2.6%) .

How do defects in Magt1 differentially impact magnesium transport versus glycosylation pathways, and what are the methodological approaches to distinguish these effects?

The dual functionality of Magt1 in magnesium transport and protein glycosylation presents a significant challenge in distinguishing pathway-specific effects. Research suggests these functions may be mechanistically linked, as Magt1-dependent glycosylation has been shown to be sensitive to Mg²⁺ levels . To distinguish between these pathways:

Magnesium transport assessment:

  • Direct measurement of intracellular free Mg²⁺ concentration using fluorescent probes

  • Analysis of Mg²⁺-dependent signaling cascades in immune cells

  • Assessment of T-cell activation and natural killer cell cytotoxicity that depend on proper Mg²⁺ homeostasis

Glycosylation pathway assessment:

  • Analysis of STT3B-specific substrate glycosylation

  • Evaluation of oxidoreductase activity independent of Mg²⁺ transport

  • Assessment of Magt1 interaction with OST complex components using proximity ligation assays

Recent evidence indicates that Magt1 deficiency impacts both pathways, but with different tissue specificities. In lymphocytes, where TUSC3 cannot compensate, both glycosylation defects and magnesium transport abnormalities are observed. In fibroblasts, TUSC3 partially compensates for glycosylation defects but not for magnesium transport defects . Researchers should design experiments that manipulate Mg²⁺ levels while monitoring glycosylation to further elucidate the relationship between these functions.

What are the molecular mechanisms through which Magt1 deficiency dysregulates platelet cation homeostasis, and how can these be experimentally validated?

Magt1 deficiency has been shown to dysregulate platelet cation homeostasis, resulting in accelerated occlusive arterial thrombus formation and shortened bleeding time in Magt1⁻/ʸ mice . The molecular mechanisms involve:

  • Increased calcium influx: Magt1 deficiency leads to enhanced calcium entry into platelets, potentiating activation signals.

  • Enhanced second wave mediator release: This reinforces platelet reactivity and aggregation responses.

  • TRPC6 channel dysregulation: Pharmacological blockade of TRPC6 (transient receptor potential cation channel) can ameliorate the thrombotic phenotype associated with Magt1 deficiency .

To experimentally validate these mechanisms, researchers should employ:

  • Real-time calcium imaging in isolated platelets under various activation conditions

  • Quantification of second wave mediators (ADP, thromboxane A2) release following platelet activation

  • Patch-clamp electrophysiology to directly measure TRPC6 channel activity

  • In vivo thrombosis models with and without TRPC6 inhibitors or with Mg²⁺ supplementation

  • Comparative proteomics to identify altered glycosylation of specific platelet receptors or signaling proteins

This research direction is particularly significant as it explains the fatal bleeding and thrombotic complications observed in patients undergoing hematopoietic stem cell transplantation for X-linked immunodeficiency with magnesium defect syndrome .

How do different Magt1 mutations impact its function in the oligosaccharyltransferase complex, and what experimental strategies can dissect structure-function relationships?

Different mutations in Magt1 have been associated with distinct clinical phenotypes, from immunodeficiency to developmental disorders . Understanding the structure-function relationships requires sophisticated experimental approaches:

Mutation TypeClinical PhenotypeFunctional ImpactExperimental Approach
Missense (e.g., p.Lys356Asn)Intellectual/developmental disabilityProtein present but functionally impairedSite-directed mutagenesis; complementation assays
Nonsense (e.g., p.Arg331*, p.Leu313*)XMEN disease or developmental disordersComplete absence of proteinWestern blotting; functional rescue experiments

To dissect these structure-function relationships:

  • Domain-specific mutagenesis: Create mutations in specific functional domains (oxidoreductase active site, membrane-spanning regions) to determine their contribution to glycosylation versus Mg²⁺ transport.

  • Chimeric protein approaches: Generate Magt1-TUSC3 chimeric proteins to identify domains responsible for their differential tissue expression and incorporation into the OST complex.

  • Functional complementation: Express mutant Magt1 variants in double-knockout (Magt1⁻/⁻TUSC3⁻/⁻) backgrounds to assess rescue of specific functions without compensatory mechanisms.

  • Interaction proteomics: Use proximity-dependent biotin identification (BioID) or cross-linking mass spectrometry to map interaction domains with OST complex components.

Research has shown that all tested patient mutations fail to rescue STT3B-mediated glycosylation in complementation assays, but their effects on Mg²⁺ transport may vary . This suggests that the glycosylation function may be more sensitive to structural perturbations. The differential tissue distribution of Magt1 versus TUSC3 further complicates the analysis and requires tissue-specific experimental approaches.

How can Magt1 research in mouse models inform therapeutic strategies for XMEN disease and congenital disorders of glycosylation?

Mouse models of Magt1 deficiency provide valuable insights for developing therapeutic strategies for both XMEN disease and congenital disorders of glycosylation (CDG). Studies using Magt1⁻/ʸ mice have revealed:

  • Glycosylation pathway targets: Genetic studies demonstrate that enhanced expression of TUSC3 can partially compensate for Magt1 deficiency in certain tissues . This suggests that upregulating TUSC3 expression could be a therapeutic approach for tissues where TUSC3 is naturally expressed.

  • Magnesium supplementation: In mouse models, MgCl₂ supplementation has shown efficacy in ameliorating certain aspects of Magt1 deficiency . This supports clinical observations where magnesium supplementation has been used in XMEN patients to improve immune function.

  • Channel-based interventions: Pharmacological blockade of TRPC6 has demonstrated efficacy in mitigating the thrombotic complications associated with Magt1 deficiency in mouse models . This represents a potential intervention to prevent the fatal bleeding and thrombotic complications observed during hematopoietic stem cell transplantation in XMEN patients.

Translational researchers should consider tissue-specific approaches, as the differential expression of TUSC3 creates distinct therapeutic windows across tissues. For instance, neurological manifestations might benefit from TUSC3 upregulation, while immune dysfunction may require magnesium supplementation combined with TRPC6 modulation to prevent thrombotic complications.

What methodological approaches can identify STT3B-specific substrates affected by Magt1 deficiency in different tissue contexts?

Identifying the complete repertoire of STT3B-specific substrates affected by Magt1 deficiency across different tissues is crucial for understanding the tissue-specific manifestations of MAGT1-related disorders. Recommended methodological approaches include:

  • MS-based glycoproteomics: This technique has successfully identified critical glycosylation defects in important immune-response proteins in Magt1-deficient models . The approach involves:

    • Enrichment of glycopeptides using lectin affinity chromatography

    • Mass spectrometry analysis to identify site-specific glycosylation changes

    • Comparative analysis between wild-type and Magt1-deficient tissues

  • RNA-Seq coupled with glycoprotein analysis: This combined approach has revealed that Magt1 deficiency affects both glycoprotein processing and gene expression, particularly of CD28 in immune cells . This methodology allows for distinguishing between direct effects on protein glycosylation versus secondary effects on gene expression.

  • Tissue-specific conditional knockout models: Generate tissue-specific Magt1 knockout mice to identify relevant substrates in:

    • Neuronal tissues (relevant to intellectual disability phenotypes)

    • Immune cells (relevant to XMEN disease)

    • Platelets and endothelial cells (relevant to thrombotic complications)

  • Glycosite occupancy analysis: Using PNGase F treatment combined with stable isotope labeling to quantify site-specific N-glycan occupancy differences between wild-type and Magt1-deficient tissues.

These approaches have identified several critical STT3B substrates affected by Magt1 deficiency, including GLUT1, SHBG, and pro-cathepsin C (pCatC) . Importantly, the glycosylation of prosaposin (pSap), an STT3A substrate, remains unaffected, confirming the specificity of Magt1 for STT3B-dependent glycosylation .

How can researchers integrate magnesium transport and glycosylation pathway analyses to develop more comprehensive models of Magt1 function?

Developing comprehensive models of Magt1 function requires integration of both magnesium transport and glycosylation pathway analyses. Researchers should consider:

  • Temporal dynamics of Mg²⁺-dependent glycosylation: Evidence suggests that Magt1-dependent glycosylation is sensitive to Mg²⁺ levels . Time-course experiments measuring both Mg²⁺ flux and glycosylation efficiency can reveal the kinetic relationship between these processes.

  • Subcellular co-localization studies: Advanced imaging techniques such as super-resolution microscopy can track Magt1 localization at the ER versus plasma membrane under different conditions, clarifying how its dual functions are regulated spatially.

  • Integrated signaling analyses: Techniques like phosphoproteomics and glycoproteomics can be combined to map how Mg²⁺ signaling intersects with glycosylation pathways.

  • Structural biology approaches: Cryo-electron microscopy of Magt1 within the OST complex can reveal how Mg²⁺ binding might influence its conformation and interaction with glycosylation machinery.

  • Systems biology modeling: Computational models incorporating both Mg²⁺ homeostasis and glycosylation pathways can predict emergent properties and generate testable hypotheses about Magt1 function.

Research has shown that reduced Mg²⁺ impairs immune cell function via the loss of specific glycoproteins , suggesting these pathways are mechanistically linked. A comprehensive model must account for the tissue-specific expression of TUSC3, which can compensate for glycosylation but not for Mg²⁺ transport functions of Magt1. This integrated approach is essential for understanding the complex phenotypes observed in XMEN disease versus developmental disorders associated with Magt1 mutations.

What are the methodological challenges in distinguishing between direct and indirect effects of Magt1 deficiency on immune cell function?

Distinguishing between direct and indirect effects of Magt1 deficiency on immune cell function presents several methodological challenges:

  • Separating glycosylation from magnesium transport effects: Since both functions can impact immune signaling, researchers must design experiments that can selectively restore one function without affecting the other. This might be achieved through:

    • Expression of chimeric proteins that retain only one functional domain

    • Selective inhibition of glycosylation pathways while maintaining magnesium homeostasis

    • Comparative analysis with TUSC3-deficient models that affect glycosylation without altering magnesium transport

  • Temporal dynamics of immune responses: Magt1 deficiency may have immediate effects on signaling and delayed effects on protein maturation and trafficking. Time-resolved analyses using single-cell approaches can help distinguish these temporal effects.

  • Compensatory mechanisms: The enhanced expression of TUSC3 in response to Magt1 deficiency can mask glycosylation defects in certain tissues. Researchers should use Magt1⁻/⁻TUSC3⁻/⁻ double knockout models for cleaner phenotypic analysis.

  • Substrate specificity: Not all glycoproteins are equally affected by Magt1 deficiency. MS-based glycoproteomics approaches have identified both immune and non-immune glycoproteins that are selectively deficient in the absence of functional Magt1 . These analyses should be extended to additional cell types and activation states.

Future research should employ conditional and inducible knockout systems to control the timing of Magt1 deletion, allowing for the separation of developmental effects from acute signaling defects in mature immune cells.

How can advanced genetic engineering approaches be applied to create more precise models of Magt1-associated human diseases?

Creating precise models of Magt1-associated human diseases requires sophisticated genetic engineering approaches:

  • Patient-specific mutations: Rather than simple knockout models, researchers should introduce specific patient mutations (e.g., p.Lys356Asn, p.Arg331*, p.Leu313*) using CRISPR/Cas9 knock-in strategies to recapitulate the exact molecular defects observed in human patients.

  • Tissue-specific models: Since Magt1 mutations lead to different phenotypes depending on the tissue context, conditional knockout models using tissue-specific Cre-lox systems can help dissect:

    • Neuronal phenotypes relevant to intellectual disability

    • Immune cell dysfunction relevant to XMEN disease

    • Platelet and vascular defects relevant to thrombotic complications

  • Humanized mouse models: Replacing mouse Magt1 with human MAGT1 can better model human disease, particularly important as subtle species differences may exist in substrate specificity or interaction partners.

  • iPSC disease modeling: Patient-derived induced pluripotent stem cells (iPSCs) can be differentiated into relevant cell types (neurons, immune cells, platelets) to study disease mechanisms in a human genetic background.

  • Temporal control systems: Inducible Magt1 deletion or expression using systems like Tet-On/Off can help distinguish between developmental versus acute effects of Magt1 deficiency.

These approaches should be complemented with detailed phenotyping that mirrors clinical assessments in humans, including:

  • Glycosylation profiling of serum proteins

  • Immune function testing including EBV susceptibility

  • Neurodevelopmental assessments

  • Platelet function and thrombosis tendency evaluation

What integrative multi-omics approaches can best elucidate the complex roles of Magt1 in health and disease?

Understanding the complex roles of Magt1 requires integrative multi-omics approaches that can capture its effects across different molecular levels:

  • Glycoproteomics combined with phosphoproteomics: This integrated approach can reveal how glycosylation defects affect downstream signaling networks. Research has shown that Magt1 deficiency impacts both immune and non-immune glycoproteins , but the consequences for signaling networks remain incompletely understood.

  • Transcriptomics with glycomics: RNA-Seq experiments have identified altered expression of genes involved in immunity, particularly CD28, in Magt1-deficient cells . Combining this with glycomics data can reveal how glycosylation changes feedback to alter gene expression.

  • Metabolomics focused on magnesium-dependent pathways: Since Magt1 regulates Mg²⁺ homeostasis, metabolomic analysis of pathways dependent on Mg²⁺ as a cofactor can reveal broader metabolic consequences of Magt1 deficiency.

  • Spatial proteomics: Mapping the subcellular distribution of affected proteins can reveal how Magt1 deficiency alters protein trafficking and localization. This is particularly relevant since Magt1 localizes to multiple cellular compartments including the ER, Golgi, and plasma membrane .

  • Single-cell multi-omics: Given the heterogeneity of immune responses, single-cell approaches combining transcriptomics, proteomics, and functional assays can reveal cell-specific consequences of Magt1 deficiency.

  • Network biology approaches: Integrating these multi-omics datasets through computational network models can identify key nodes and pathways connecting Magt1's dual functions in magnesium transport and glycosylation.

These integrative approaches are essential for developing a comprehensive understanding of how Magt1 deficiency leads to diverse clinical manifestations ranging from immunodeficiency to developmental disorders and thrombotic complications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.