Recombinant Mouse MAL-like protein (Mall)

What is Mouse MAL-like protein (Mall) and how does it relate to the MAL protein family?

Mouse MAL-like protein (Mall), also known as protein BENE, is a 154-amino acid membrane protein belonging to the MAL proteolipid family. The Mall protein is structurally characterized by four putative transmembrane segments similar to other MAL family members. Mall is part of the larger MARVEL (MAL and Related proteins for Vesicle trafficking and membrane Link) domain-containing superfamily, which includes MAL, physin, and TAMP families. Within the MAL family specifically, Mall shares structural features with MAL, MAL2, PLLP, and CMTM8, all displaying tetraspanning topology . The Mall protein sequence (MASRDTPPATSYAPPDVPSGVAALFLTIPFAFFLPELVFGFWVWTLVAATHVAYPLLQGWLYVSLTSFLISLMFLMSYLFGFYKRFESWRVLDSLYHGTTGILYMSASVLQAYATIISEGHNLSHYYINVAASFFAFLTTLLYILHAFSIYYH) contains regions that facilitate its integration into specialized membrane domains .

What are the key structural features of recombinant Mouse Mall protein?

Recombinant Full Length Mouse Mall protein typically consists of the complete 154-amino acid sequence (residues 1-154) of the native protein. The protein contains four transmembrane domains that adopt a configuration similar to other MARVEL domain-containing proteins. While the exact 3D structure of Mall has not been determined, insights from related proteins like synaptophysin (another MARVEL superfamily member) suggest it may form oligomeric structures within membranes. Synaptophysin adopts a hexameric basket-like complex with six spokes, each corresponding to a protein subunit . Recombinant versions of the protein are often produced with affinity tags (such as His-tag) fused to the N-terminus to facilitate purification and detection in experimental settings .

How does Mall differ from the canonical MAL protein in terms of expression pattern and function?

While both MAL and Mall (MAL-like protein) share structural similarities as members of the MAL proteolipid family, they differ in their tissue expression patterns and specific functions:

Both proteins share the ability to partition into detergent-resistant membranes (DRMs) and associate with highly ordered membrane domains, suggesting a common role in membrane organization, though in different cellular contexts .

Where is Mall protein typically localized within cells and what membrane domains does it associate with?

Mouse Mall protein predominantly localizes to glycolipid- and cholesterol-enriched membrane (GEM) rafts, which are specialized membrane microdomains rich in sphingolipids and cholesterol . Similar to other MAL family proteins, Mall demonstrates a high affinity for detergent-resistant membranes (DRMs), suggesting its preference for highly ordered membrane domains. This selective partitioning into condensed membranes is a defining characteristic that reflects its functional role in membrane organization and trafficking.

In cellular distribution studies of related MAL family proteins, these molecules have been found at the plasma membrane and in cytoplasmic tubulovesicular structures, with smaller fractions in clathrin-coated structures, multivesicular endosomes, and Golgi-associated structures . Mall's specific interaction with caveolin-1 suggests an association with caveolae, which are specialized invaginations of the plasma membrane involved in endocytosis and signal transduction .

What is the role of Mall in membrane trafficking and organization?

Mall functions as an element of the machinery for raft-mediated trafficking in endothelial cells . Like other MAL family proteins, Mall likely contributes to the organization and function of specialized membrane domains. The MARVEL domain present in Mall is believed to play a crucial role in membrane apposition and fusion events during vesicular transport.

Based on studies of related proteins like MAL, Mall may participate in:

• The organization of condensed membrane domains to make them functional

• Facilitating the movement of specific cargo proteins between membrane compartments

• Stabilizing membrane domains through its lipid-like properties and high affinity for ordered membrane environments

Mall's interaction with caveolin-1 suggests a potential role in caveolae-mediated endocytosis and signaling, though the precise mechanisms require further investigation .

How does the membrane partitioning behavior of Mall influence its biological functions?

The preferential partitioning of Mall into detergent-resistant membranes (DRMs) and its localization to glycolipid- and cholesterol-enriched membrane domains are fundamental to its biological functions. This selective membrane association allows Mall to:

• Serve as an organizer of specialized membrane domains by recruiting specific lipids and proteins to these regions

• Facilitate the segregation of cargo proteins destined for specific trafficking routes

• Contribute to the structural integrity of membrane microdomains through its lipid-like properties

Studies of related MAL family proteins have demonstrated that their membrane partitioning behavior is not merely an artifact of isolation procedures but reflects their genuine preference for compact, ordered membrane environments in living cells. This property enables Mall to function in the specialized trafficking machinery of endothelial cells, possibly by creating platforms that concentrate specific cargo proteins and the molecular machinery needed for their transport .

What are the optimal storage and handling conditions for recombinant Mouse Mall protein?

For optimal stability and activity of recombinant Mouse Mall protein, researchers should follow these storage and handling guidelines:

• Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store at -20°C/-80°C with the addition of glycerol (recommended final concentration of 50%)

  • For working aliquots, store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

• Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

  • Aliquot to minimize freeze-thaw cycles

• Buffer compatibility:

  • The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • When designing experiments, consider this buffer composition for compatibility with downstream applications

What methods are most effective for detecting and quantifying Mall protein in experimental systems?

Several methods can be employed for detecting and quantifying Mall protein in experimental systems:

• Western blotting:

  • Use anti-Mall antibodies (such as ANTI-MALL CENTER antibody) for detection

  • The His-tag on recombinant versions can be detected using anti-His antibodies

  • Optimal separation is achieved on 12-15% SDS-PAGE gels due to Mall's relatively small size (17 kDa)

• Flow cytometry:

  • Can be used for analyzing Mall expression in intact cells

  • Anti-Mall antibodies have been validated for flow cytometry applications with human and mouse samples

• Immunohistochemistry/Immunofluorescence:

  • For tissue sections or cultured cells

  • Based on studies with related MAL proteins, detection may be optimized in frozen sections

  • Fixation methods should be carefully selected to preserve membrane protein epitopes

• Membrane fractionation:

  • Detergent resistance assays using Triton X-100 extraction at 4°C

  • Density gradient centrifugation to isolate DRM fractions

  • These methods can assess the membrane partitioning behavior of Mall

• Protein quantification:

  • Standard methods (Bradford, BCA) for total protein determination

  • ELISA-based approaches for specific quantification

  • His-tag-based quantification systems for recombinant protein

How can researchers effectively use Mall protein in membrane organization studies?

To effectively use Mall protein in membrane organization studies, researchers can employ several approaches:

• Reconstitution in artificial membrane systems:

  • Liposomes with defined lipid compositions to study Mall's membrane partitioning

  • Giant plasma membrane vesicles to visualize Mall distribution between ordered and disordered phases

  • Supported lipid bilayers for high-resolution imaging of Mall-mediated domain formation

• Cellular transfection studies:

  • Expression of tagged Mall constructs in relevant cell types

  • Live-cell imaging to track Mall trafficking between membrane compartments

  • Co-expression with other membrane proteins to assess potential interactions

• Membrane domain isolation:

  • Detergent extraction methods to isolate DRMs containing Mall

  • Immunoisolation of Mall-containing membrane vesicles

  • Proteomic analysis of isolated fractions to identify Mall-associated proteins

• Functional assays:

  • Membrane trafficking assays to assess the impact of Mall expression/depletion

  • Vesicle formation and fusion assays to evaluate Mall's role in membrane dynamics

  • Assessment of the distribution of known raft markers in response to Mall manipulation

How can gene editing approaches be used to study Mall function in endothelial cells?

Advanced gene editing approaches offer powerful tools for investigating Mall function in endothelial cells:

• CRISPR/Cas9-mediated knockout:

  • Design guide RNAs targeting different exons of the Mall gene

  • Generate complete knockout cell lines to assess the consequences of Mall absence

  • Create endothelial-specific knockout mouse models to study systemic effects

• Knock-in strategies:

  • Insert fluorescent tags (GFP, mCherry) to track Mall localization in real-time

  • Introduce specific mutations to disrupt:

    • Membrane partitioning behavior

    • Interaction with caveolin-1

    • Transmembrane domain function

• Inducible expression systems:

  • Develop Tet-on/off systems for temporal control of Mall expression

  • Create cell lines with variable Mall expression levels to assess dose-dependent effects

  • Design rescue experiments with wild-type and mutant Mall variants

• Single-cell analysis:

  • Combine gene editing with single-cell transcriptomics to identify Mall-dependent gene expression patterns

  • Use multiplexed CRISPR screening to identify genetic interactions with Mall

When designing these experiments, researchers should consider that Mall functions as part of the raft-mediated trafficking machinery in endothelial cells, and its disruption may affect multiple cellular processes related to membrane organization and trafficking .

What are the approaches for studying the interaction between Mall and caveolin-1 in membrane microdomains?

The interaction between Mall and caveolin-1 in membrane microdomains can be investigated using several complementary approaches:

• Biochemical interaction assays:

  • Co-immunoprecipitation of Mall and caveolin-1 from cell lysates

  • Proximity ligation assays to detect interactions in situ

  • FRET/BRET assays to measure direct interactions in living cells

  • In vitro binding assays with purified proteins to assess direct interaction

• Advanced imaging techniques:

  • Super-resolution microscopy (STORM, PALM) to visualize co-localization at nanoscale resolution

  • Live-cell TIRF microscopy to track interactions at the plasma membrane

  • Correlative light and electron microscopy to relate fluorescence signals to ultrastructural features

  • Fluorescence recovery after photobleaching (FRAP) to measure dynamics in membrane domains

• Membrane microdomain manipulation:

  • Cholesterol depletion/loading to alter raft integrity

  • Expression of dominant-negative caveolin mutants

  • Targeted disruption of Mall-caveolin binding interfaces

  • Lipid composition alterations to modify membrane properties

• Functional readouts:

  • Endocytosis assays to measure caveolae-mediated internalization

  • Signal transduction analyses focusing on pathways associated with caveolae

  • Membrane trafficking assays to assess cargo sorting and transport

These approaches should consider that both Mall and caveolin-1 are found in glycolipid- and cholesterol-enriched membrane rafts, and their interaction may be influenced by the lipid environment .

How does the membrane partitioning behavior of Mall compare to other MARVEL domain-containing proteins in experimental systems?

The membrane partitioning behavior of Mall can be compared to other MARVEL domain-containing proteins through several experimental approaches:

• Comparative detergent resistance profiles:

  Protein	Detergent Resistance	Membrane Domain Preference	Cholesterol Dependence
  Mall	High	GEM rafts	Strong
  MAL	Very high	DRMs/compact membranes	Strong
  Synaptophysin	Moderate	Synaptic vesicles	Moderate
  CMTM family	Variable	Cell-type dependent	Variable
  Occludin (TAMP)	Moderate	Tight junctions	Moderate

• Artificial membrane systems:

  • In giant plasma membrane vesicles, MAL shows exceptionally high affinity for ordered domains, comparable to GPI-anchored proteins and cholera toxin (which binds GM1 ganglioside)

  • Mall likely exhibits similar behavior, though potentially with distinctive preferences for specific lipid compositions

  • Systematic comparison of different MARVEL proteins in the same membrane systems would reveal their relative affinities for ordered domains

• Advanced imaging approaches:

  • Single-particle tracking to measure diffusion coefficients in different membrane environments

  • Fluorescence correlation spectroscopy to analyze dynamics at the single-molecule level

  • Cross-correlation analyses to detect co-diffusion with established raft markers

• Molecular determinants:

  • Chimeric constructs exchanging transmembrane domains between different MARVEL proteins

  • Systematic mutagenesis of key residues in transmembrane regions

  • Analysis of post-translational modifications affecting membrane partitioning

These comparative studies would provide insights into how structural variations within the MARVEL domain family translate to functional differences in membrane organization and trafficking .

What are common challenges in expressing and purifying functional recombinant Mouse Mall protein?

Researchers working with recombinant Mouse Mall protein face several challenges during expression and purification:

• Expression challenges:

  • As a membrane protein with four transmembrane domains, Mall can be difficult to express in soluble form

  • Protein misfolding and aggregation in bacterial expression systems

  • Toxicity to host cells when overexpressed

  • Formation of inclusion bodies requiring refolding procedures

• Purification obstacles:

  • Detergent selection is critical for maintaining native structure

  • Incomplete extraction from membranes

  • Co-purification of host cell lipids and proteins

  • Potential loss of function during purification steps

  • Tag accessibility issues due to Mall's membrane topology

• Quality control considerations:

  • Assessing proper folding of a membrane protein is challenging

  • Batch-to-batch variation in lipid content

  • Differentiating between monomeric and oligomeric forms

  • Limited stability after reconstitution

  • Potential loss of lipid-like properties during processing

To address these challenges, researchers can:

• Use specialized expression systems designed for membrane proteins

• Optimize detergent conditions carefully

• Employ mild purification conditions

• Include stability-enhancing additives like trehalose

• Validate protein functionality through membrane association assays

How can researchers troubleshoot experiments where Mall protein fails to partition into membrane microdomains?

When Mall protein fails to partition into membrane microdomains as expected, researchers should consider the following troubleshooting approaches:

• Experimental conditions assessment:

  • Verify detergent type, concentration, and extraction temperature for DRM isolation

  • Ensure proper buffer conditions (pH, ionic strength) that maintain membrane integrity

  • Check cholesterol content in the membrane systems being used

  • Confirm that the isolation procedure preserves raft domains

• Protein integrity verification:

  • Assess protein folding and integrity by circular dichroism or limited proteolysis

  • Verify that tags or modifications are not interfering with membrane association

  • Examine post-translational modifications that might affect partitioning

  • Confirm proper reconstitution into membranes

• Cell/membrane system evaluation:

  • Analyze lipid composition of the membranes being studied

  • Verify the presence of established raft markers as positive controls

  • Consider cell type-specific differences in membrane organization

  • Evaluate effects of cell density, polarization state, and culture conditions

• Alternative approaches:

  • Try multiple methods for detecting membrane domain association

  • Use gentler membrane fractionation techniques

  • Consider in situ approaches like cross-linking prior to extraction

  • Employ live-cell imaging of fluorescently tagged Mall

Based on studies of MAL family proteins, proper trafficking to compact membrane domains may depend on specific sequence motifs or protein modifications, and disruption of these features could alter membrane partitioning behavior .

What quality control methods should be applied to verify the structural integrity and functionality of recombinant Mall protein?

To ensure the structural integrity and functionality of recombinant Mouse Mall protein, researchers should implement a comprehensive quality control workflow:

• Physical characterization:

  • SDS-PAGE to verify size and purity (>90% purity recommended)

  • Western blotting with anti-Mall and anti-tag antibodies

  • Mass spectrometry to confirm protein identity and detect modifications

  • Circular dichroism to assess secondary structure elements

  • Dynamic light scattering to evaluate aggregation state

• Functional validation:

  • Membrane association assays to verify partitioning into DRMs

  • Liposome binding assays to confirm lipid interactions

  • Caveolin-1 binding assays to verify protein-protein interactions

  • Structural stability tests under various conditions

• Biological activity assessment:

  • Cell-based assays examining Mall function in membrane trafficking

  • Comparison with native Mall protein from appropriate tissues

  • Rescue experiments in Mall-depleted systems

  • Co-localization with known Mall-interacting proteins

• Storage stability monitoring:

  • Periodic testing of stored aliquots to determine shelf life

  • Assessment of freeze-thaw tolerance

  • Evaluation of activity after reconstitution from lyophilized state

  • Testing of different buffer formulations for optimal stability

Documentation of these quality control measures is essential for experimental reproducibility, especially given the challenges associated with membrane protein handling and the sensitivity of Mall's function to its conformation and lipid environment .