Recombinant Mouse Mannose-P-dolichol utilization defect 1 protein (Mpdu1)

Shipped with Ice Packs
In Stock

Description

Introduction to Mpdu1 and Its Biological Role

The recombinant mouse Mannose-P-Dolichol Utilization Defect 1 (Mpdu1) protein is a critical enzyme involved in glycosylation processes. It facilitates the utilization of mannose-P-dolichol (Man-P-Dol), a donor substrate essential for lipid-linked oligosaccharide (LLO) biosynthesis and glycosylphosphatidylinositol (GPI) anchor assembly. Mpdu1 orthologs, such as human MPDU1, are implicated in congenital disorders of glycosylation (CDG), specifically CDG-If, characterized by hypoglycosylated transferrin and truncated LLOs .

Key Functional Domains

  • 7-transmembrane (7TM) structure: Shared with other cargo receptors, suggesting roles in substrate utilization or trafficking .

  • Proline-Quantamine (PQ) motifs: Conserved residues critical for enzyme activity .

Biochemical Functions

Mpdu1 participates in:

  1. N-linked glycosylation: Man-P-Dol donates mannose residues to growing LLOs .

  2. C-mannosylation: Modifies tryptophan residues in proteins .

  3. GPI anchor synthesis: Contributes to GPI lipid anchor formation .

Expression Platforms

Host SystemAdvantagesApplications
Cell-free systemsHigh yield, rapid productionStructural studies, enzymatic assays
E. coliCost-effective, scalableBiochemical characterization
Mammalian cellsNative post-translational modificationsFunctional studies in homologous pathways

Purification Protocols

  • Cell-free expression: Directly purified from reaction mixtures .

  • Tagged proteins: His-tagged versions enable nickel-affinity chromatography .

Biochemical Assays

ApplicationMethodologyOutcomes
LLO synthesis analysisPulse-chase radiolabeling with [2-³H]mannoseDetect truncated LLOs in Mpdu1-deficient models
DPM utilizationEnzymatic assays with Man-P-Dol substratesQuantify transferase activity

Disease Modeling

  • CDG-If replication: Mpdu1-knockout models exhibit reduced α-dystroglycan (α-DG) O-mannosylation, linking to muscular dystrophy .

  • Biliary duct dilation: Observed in Mpdu1 mutant mice, mirroring human CDG-If patients .

Mechanistic Insights

  1. Substrate utilization: Mpdu1 facilitates Man-P-Dol and Glc-P-Dol incorporation into LLOs, critical for proper glycosylation .

  2. Disease pathogenesis: Mutations (e.g., L74S in humans) disrupt LLO maturation, leading to hypoglycosylated proteins and cellular dysfunction .

Therapeutic Implications

  • Gene therapy: Retroviral delivery of wild-type MPDU1 restores LLO biosynthesis in patient fibroblasts .

  • Enzyme replacement: Recombinant Mpdu1 supplementation may bypass defective endogenous pathways .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mpdu1; Supl15h; Mannose-P-dolichol utilization defect 1 protein; Suppressor of Lec15 and Lec35 glycosylation mutation homolog; SL15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-247
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Mpdu1
Target Protein Sequence
AGEADGRFKGLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQ VFKLLGAKSAEGLSLQSVMLELVALTGTVVYSITNNFPFSSWGEALFLTLQTVAICFLVM HYRGETVKGVAFLACYAMVLLALLSPLTPLAVVTLLQASNVPAVVVGKLLQAATNYRNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKAPH KQKKEQ
Uniprot No.

Target Background

Function
Essential for the normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the biosynthesis of N-linked and O-linked oligosaccharides and GPI anchors.
Database Links
Protein Families
MPDU1 (TC 2.A.43.3) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Mouse Mpdu1 protein?

Mouse Mpdu1 (mannose-P-dolichol utilization defect 1) encodes an endoplasmic reticulum membrane protein that is essential for the utilization of mannose-P-dolichol as a donor in the synthesis of lipid-linked oligosaccharides (LLOs) and glycosylphosphatidylinositols (GPIs). The protein plays a critical role in facilitating the use of dolichol-phosphate-mannose (DPM) for various glycosylation processes, including N-glycosylation and O-mannosylation. Without functional Mpdu1, cells cannot efficiently utilize DPM, leading to defects in multiple glycosylation pathways that are essential for proper cell function and development. The gene's importance is underscored by its high conservation across numerous mammalian species, suggesting a fundamental role in cellular processes .

How conserved is Mpdu1 across species?

Mpdu1 demonstrates remarkable evolutionary conservation across mammalian species. Comparative sequence analysis reveals high homology between human, mouse, and hamster MPDU1 proteins, indicating strong selection pressure to maintain its function throughout evolution. This conservation extends to numerous species including rat, cow, horse, dog, domestic cat, domestic guinea pig, naked mole-rat, and sheep, all of which possess identifiable MPDU1 homologs . In porcine studies, the cloned MPDU1 gene showed significant similarity to human and mouse counterparts, further confirming the cross-species conservation. This high degree of conservation suggests that the protein's function in mannose-P-dolichol utilization is fundamental to mammalian cellular biochemistry and has been maintained throughout evolutionary divergence of these species .

What cellular pathways is Mpdu1 involved in?

Mpdu1 is integral to several glycosylation pathways critical for proper cellular function. Primarily, it facilitates the utilization of dolichol-phosphate-mannose (DPM) as a mannose donor in:

  • N-glycosylation: The synthesis of lipid-linked oligosaccharides that are subsequently transferred to proteins in the endoplasmic reticulum

  • O-mannosylation: The addition of mannose residues to serine or threonine residues in proteins like α-dystroglycan

  • GPI-anchor biosynthesis: The assembly of glycosylphosphatidylinositol anchors that attach certain proteins to cell membranes

These pathways are interdependent, as demonstrated in studies of MPDU1-deficient cells which show impairments across multiple glycosylation processes. The protein appears to function as a facilitator rather than a direct enzyme, potentially organizing or transporting mannose-containing lipid intermediates within the endoplasmic reticulum membrane. This organizational role makes Mpdu1 a critical node in cellular glycosylation networks, influencing protein folding, cellular recognition, and membrane structure .

What methods are most effective for analyzing Mpdu1 gene mutations?

Denaturing high-pressure liquid chromatography (DHPLC) has emerged as a particularly sensitive and efficient method for analyzing mutations in the MPDU1 gene. This technique provides virtually 100% sensitivity in detecting mutations when properly optimized. The approach involves:

  • PCR amplification of individual exons using carefully designed primers specific to the MPDU1 gene regions

  • Optimization of DHPLC conditions for each exon to maximize mutation detection sensitivity

  • Analysis of heteroduplex formation during DHPLC, which indicates the presence of mutations

  • Confirmation of detected mutations through direct sequencing

DHPLC offers significant advantages over direct sequencing alone, including higher throughput, cost-effectiveness, and superior detection of heterozygous mutations. For comprehensive mutation screening, researchers should design primers that cover all exons and important intronic regions of the Mpdu1 gene. Following DHPLC detection of potential mutations, targeted sequencing confirms the precise nature of the genetic alteration. This combined approach has successfully identified numerous mutations in MPDU1 and related genes involved in congenital disorders of glycosylation (CDG) .

What are the recommended approaches for cloning and expressing recombinant Mouse Mpdu1?

For successful cloning and expression of recombinant Mouse Mpdu1, a multifaceted approach combining in silico analysis with molecular techniques has proven effective. The recommended methodology includes:

  • Initial in silico cloning using known Mpdu1 sequences from related species (e.g., human NM_004870) to identify conserved regions

  • Identification of mouse ESTs with >80% identity to human MPDU1 to assemble a consensus sequence

  • Design of gene-specific primers (GSPs) based on the consensus for Rapid Amplification of cDNA Ends (RACE)

  • Total RNA extraction from appropriate mouse tissue (typically liver or muscle) using TRIzol reagent

  • Synthesis of first-strand cDNAs followed by 5' and 3' RACE to obtain full-length cDNA

  • PCR amplification with primers spanning the complete coding sequence

  • Cloning into an appropriate expression vector with a fusion tag (typically His-tag) to facilitate purification

  • Expression in a mammalian cell system (preferably HEK293 or CHO cells) rather than bacterial systems, as Mpdu1 is a membrane protein requiring proper post-translational modifications

This approach ensures the generation of functional recombinant Mpdu1 protein that maintains its native characteristics. The expression system is particularly important for Mpdu1, as bacterial systems often fail to properly fold this membrane protein or provide the necessary post-translational modifications .

What cellular models are most appropriate for studying Mpdu1 function?

Several cellular models have proven valuable for investigating Mpdu1 function, each offering distinct advantages depending on the research question:

  • CRISPR/Cas9-generated knockout cell lines: HEK293 cells with MPDU1 gene deletion provide a clean system for studying the consequences of complete Mpdu1 deficiency. These models are particularly useful for analyzing glycosylation pathways affected by Mpdu1 loss.

  • Patient-derived fibroblasts: Cells from individuals with MPDU1-CDG contain natural mutations and exhibit physiologically relevant defects in glycosylation, making them valuable for studying disease mechanisms and potential therapeutic approaches.

  • Mouse embryonic fibroblasts (MEFs): These can be derived from Mpdu1 knockout or conditional knockout mice and provide a primary cell model with a controlled genetic background.

  • Lec35 mutant CHO cells: These classic cell lines carry mutations in the hamster MPDU1 gene and have been instrumental in defining the role of Mpdu1 in glycosylation pathways.

When selecting a model, researchers should consider the specific aspect of Mpdu1 function under investigation. For biochemical studies of glycosylation intermediates, PIGS-SYVN1-CLPTM1L-triple knockout HEK293 cells have proven valuable for detecting Man-containing GPI intermediates. For studying interactions with other proteins in the glycosylation machinery, models with tagged Mpdu1 variants that maintain protein functionality are recommended .

How can the effects of Mpdu1 deficiency on glycosylation be quantitatively assessed?

Quantitative assessment of glycosylation defects resulting from Mpdu1 deficiency requires multiple complementary approaches:

  • Radiolabeling studies with [³H]Man: This technique allows tracking of mannose incorporation into glycoconjugates. After cellular uptake, mannose is converted to dolichol-phosphate-mannose (DPM), which serves as the mannose donor for glycosylation processes. In MPDU1-deficient cells, reduced incorporation of radiolabeled mannose into glycosylation intermediates and mature glycoproteins can be quantitatively measured, providing direct evidence of impaired mannose utilization .

  • Transferrin isoelectric focusing: Analysis of serum transferrin glycoforms reveals characteristic patterns in CDG-I disorders, including MPDU1-CDG. Elevated disialotransferrin in serum serves as a biomarker for N-glycosylation defects. This technique provides a quantifiable measure of glycosylation impairment in clinical samples .

  • Structural analysis of lipid-linked oligosaccharides (LLOs): MPDU1 deficiency leads to characteristic changes in LLO structures, particularly shortened oligosaccharide chains. High-performance liquid chromatography (HPLC) or mass spectrometry analysis of these structures provides quantitative data on the specific steps in the glycosylation pathway affected by Mpdu1 dysfunction .

  • Assessment of α-dystroglycan glycosylation: O-mannosylation of α-dystroglycan can be measured using specialized antibodies that recognize glycosylated epitopes. Western blotting with densitometric analysis provides a quantitative readout of this specific glycosylation pathway affected by Mpdu1 deficiency .

These complementary approaches allow researchers to comprehensively evaluate the impact of Mpdu1 deficiency across multiple glycosylation pathways, providing both qualitative and quantitative data on the specific steps disrupted by Mpdu1 dysfunction.

What are the key differences between human MPDU1 and mouse Mpdu1 in experimental contexts?

While human MPDU1 and mouse Mpdu1 share high sequence homology and functional conservation, several differences are relevant in experimental contexts:

  • Expression patterns: Mouse Mpdu1 shows some tissue-specific expression differences compared to human MPDU1, which may influence the interpretation of tissue-specific phenotypes in mouse models versus human disease.

  • Interaction partners: Subtle differences exist in protein-protein interactions between species, potentially affecting how the proteins function within larger glycosylation complexes.

  • Regulatory elements: The promoter regions and regulatory mechanisms controlling Mpdu1 expression differ between species, which impacts experimental approaches targeting gene expression.

  • Antibody cross-reactivity: Not all antibodies against human MPDU1 cross-react with mouse Mpdu1 and vice versa, necessitating careful selection of detection reagents.

  • Disease phenotypes: While MPDU1 deficiency causes congenital disorders of glycosylation in both species, the specific manifestations and severity may differ, influencing the translation of findings between mouse models and human patients.

How does Mpdu1 interact with other components of the glycosylation machinery?

Mpdu1 functions within a complex network of proteins involved in the glycosylation machinery, primarily within the endoplasmic reticulum membrane. Key interactions include:

These interactions position Mpdu1 as a crucial facilitator rather than a direct enzyme in glycosylation pathways. Its precise molecular mechanism likely involves organizing lipid and protein components within the ER membrane to create optimal microenvironments for glycosylation reactions that depend on DPM as a substrate.

What are the major phenotypic consequences of Mpdu1 mutations in experimental models?

Experimental models with Mpdu1 mutations or deficiency display a range of phenotypic consequences that reflect the protein's critical role in glycosylation:

  • Cellular glycosylation defects: The most direct consequence is impaired utilization of dolichol-phosphate-mannose (DPM), leading to:

    • Shortened lipid-linked oligosaccharides (LLOs)

    • Reduced mannose incorporation into glycoproteins

    • Impaired GPI-anchor biosynthesis

    • Defects in protein O-mannosylation

  • Biochemical abnormalities: Analytical techniques reveal characteristic patterns including:

    • Elevated disialotransferrin in serum

    • Accumulation of incomplete glycosylation intermediates

    • Altered mobility of glycoproteins on gel electrophoresis

  • Cellular phenotypes: At the cellular level, consequences include:

    • Endoplasmic reticulum stress

    • Altered protein trafficking

    • Changes in cell morphology and adhesion properties

    • Modified cellular response to stress conditions

  • Tissue-specific manifestations: In more complex models, tissue-specific effects may include:

    • Neurological development abnormalities

    • Muscular abnormalities resembling dystroglycanopathies

    • Hepatic and biliary system defects

    • Ocular development issues

These phenotypic consequences provide valuable insights into both the normal function of Mpdu1 and the pathophysiology of MPDU1-CDG in humans. The variability in manifestations reflects the diverse roles of proper glycosylation across different cell types and developmental processes .

How does Mpdu1 deficiency contribute to congenital disorders of glycosylation?

Mpdu1 deficiency leads to a specific type of congenital disorder of glycosylation (CDG-If) through several interconnected mechanisms:

  • Impaired N-glycosylation: Without functional Mpdu1, cells cannot efficiently utilize dolichol-phosphate-mannose (DPM) for the synthesis of lipid-linked oligosaccharides (LLOs). This results in incomplete LLOs that lack mannose residues, leading to hypoglycosylation of proteins in the secretory pathway. The characteristic transferrin isoelectric focusing pattern seen in MPDU1-CDG patients reflects this N-glycosylation defect .

  • Disrupted O-mannosylation: Mpdu1 is required for the utilization of DPM in O-mannosylation pathways, particularly those affecting α-dystroglycan. Defective O-mannosylation of α-dystroglycan contributes to the muscular symptoms observed in patients, resembling dystroglycanopathies with hypotonia and elevated creatine kinase levels .

  • GPI-anchor biosynthesis defects: Proper synthesis of GPI anchors also requires DPM as a mannose donor. Mpdu1 deficiency compromises this process, potentially affecting the surface expression and function of GPI-anchored proteins involved in various cellular processes .

  • Combined glycosylation abnormalities: MPDU1-CDG is notable for causing overlapping biochemical and clinical features of different CDG types, as it affects multiple glycosylation pathways simultaneously. This explains why patients may present with a combination of symptoms typically seen in separate glycosylation disorders .

The diverse clinical manifestations observed in MPDU1-CDG patients, including biliary duct dilatation, cardiomyopathy, buphthalmos, and congenital glaucoma, reflect the importance of proper glycosylation in multiple organ systems during development and throughout life .

What therapeutic approaches are being investigated for conditions related to Mpdu1 dysfunction?

Research into therapeutic approaches for Mpdu1-related disorders is still in early stages, but several strategies are being investigated:

These therapeutic strategies are currently mostly in preclinical development stages, with clinical applications still on the horizon. The complex nature of Mpdu1's role in multiple glycosylation pathways presents challenges for developing comprehensive treatments, potentially necessitating combination approaches tailored to individual patient manifestations .

What are the most promising techniques for studying Mpdu1 protein-protein interactions?

Several advanced techniques have emerged as particularly valuable for investigating Mpdu1 protein-protein interactions:

  • Proximity-dependent biotin identification (BioID): This approach involves fusing Mpdu1 to a promiscuous biotin ligase that biotinylates proteins in close proximity. When expressed in cells, the fusion protein labels neighboring proteins, which can then be isolated using streptavidin and identified by mass spectrometry. This technique is especially useful for studying membrane proteins like Mpdu1 and can capture both stable and transient interactions within the native cellular environment.

  • Split-ubiquitin membrane yeast two-hybrid system: Unlike conventional yeast two-hybrid, this modified system is specifically designed for membrane proteins. It has proven effective for identifying interactions between components of the glycosylation machinery, including potential Mpdu1 partners.

  • Co-immunoprecipitation with crosslinking: Chemical crosslinking prior to immunoprecipitation helps stabilize transient interactions that might otherwise be lost during cell lysis and purification. This is particularly important for Mpdu1, which may form functional complexes with other glycosylation components in the ER membrane.

  • FRET/BRET-based interaction assays: Fluorescence or bioluminescence resonance energy transfer techniques allow for the detection of protein-protein interactions in living cells. By tagging Mpdu1 and potential interaction partners with appropriate fluorophores or luciferase, researchers can monitor interactions in real-time.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides information about protein dynamics and interactions by measuring the exchange rate of hydrogen atoms. It can identify regions of Mpdu1 that undergo conformational changes upon binding to partners or substrates.

These complementary approaches provide a comprehensive toolkit for elucidating the interaction network of Mpdu1 within the glycosylation machinery, helping to clarify its precise molecular function in facilitating mannose-P-dolichol utilization .

What are the challenges in developing effective knockout and knockin mouse models for Mpdu1 research?

Developing effective genetic mouse models for Mpdu1 research presents several significant challenges:

  • Embryonic lethality: Complete knockout of Mpdu1 may result in embryonic lethality due to the fundamental importance of glycosylation pathways during development. This necessitates the development of conditional knockout strategies using Cre-loxP systems to study tissue-specific effects.

  • Compensatory mechanisms: Mice may develop compensatory mechanisms that partially rescue glycosylation defects, potentially masking phenotypes that would be observed in human patients. Identifying and understanding these compensatory pathways becomes an additional research challenge.

  • Generating precise mutations: Creating knockin models with specific patient mutations requires precise genome editing. While CRISPR/Cas9 has simplified this process, introducing subtle missense mutations while avoiding off-target effects remains technically challenging.

  • Phenotypic assessment: The diverse glycosylation pathways affected by Mpdu1 deficiency require comprehensive phenotyping across multiple organ systems. Developing standardized protocols to assess glycosylation status in various tissues is essential for consistent analysis.

  • Background strain effects: The genetic background of mice can significantly influence the penetrance and expressivity of Mpdu1 mutations. Researchers must consider whether to maintain models on pure backgrounds or use mixed backgrounds that might better mimic human genetic diversity.

  • Temporal control: Glycosylation requirements change throughout development and adult life. Inducible knockout systems may be necessary to distinguish developmental from maintenance roles of Mpdu1 in glycosylation pathways.

Despite these challenges, successful Mpdu1 mouse models would provide invaluable tools for understanding disease mechanisms and testing potential therapeutic approaches for MPDU1-CDG and related disorders .

How might high-throughput screening be optimized to identify compounds that modulate Mpdu1 function?

Optimizing high-throughput screening (HTS) for Mpdu1 modulators requires specialized approaches due to the unique challenges presented by this membrane protein involved in glycosylation:

  • Cellular reporter systems: Developing cell lines with fluorescent or luminescent reporters that respond to glycosylation status provides a direct readout of Mpdu1 function. Ideal reporters would link glycosylation-dependent protein folding or trafficking to easily measurable signals.

  • Target-based vs. phenotypic screening: While direct binding assays for membrane proteins are challenging, phenotypic screens measuring glycosylation outcomes may be more productive. Multiplex assays that simultaneously assess multiple glycosylation pathways dependent on Mpdu1 (N-glycosylation, O-mannosylation, and GPI-anchor biosynthesis) could identify compounds with comprehensive effects.

  • Patient-derived cellular models: Screening in cells from MPDU1-CDG patients or engineered cells with patient-specific mutations increases disease relevance. These models could be particularly valuable for identifying mutation-specific therapeutic compounds.

  • Computational pre-screening: Molecular docking and virtual screening approaches can prioritize compound libraries before physical screening, particularly if structural information about Mpdu1 or close homologs becomes available.

  • Fragment-based screening: For membrane proteins like Mpdu1, fragment-based approaches might be more successful than traditional HTS. Small chemical fragments that show weak binding can be identified and then optimized or combined to develop more potent compounds.

  • Biosensor development: Engineering Mpdu1 variants with inserted biosensor domains that report on conformational changes or functional states could enable direct screening for compounds that modulate protein activity.

The most promising screening hits would require secondary validation assays measuring specific glycosylation outcomes, such as LLO profile analysis, transferrin glycoform assessment, or measurement of GPI-anchored protein expression. Compounds identified through such optimized screening approaches could potentially lead to therapeutic candidates for MPDU1-CDG or research tools to better understand Mpdu1 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.