Recombinant Mouse MARVEL domain-containing protein 2 (Marveld2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Typically, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Marveld2; Mrvldc2; Tric; MARVEL domain-containing protein 2; Tricellulin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-555
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Marveld2
Target Protein Sequence
MSSSDARSRIRDRGYSEVPRDTSCPDGTIRTFQSLHSSELAVSADPLPPPPLPLQPPFGP SFYSSDTEEPAVAPDLKPVRRFVPDSWKNFFRGKKKDPEWDNPVSDIRYISDGVECSPPA SPARANHHPYKDPSRGSQGTFNSQHEADAMFAHDPYASLDRRTQTARTYSEKVEEYNLRY AYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDNEWYNLFGYTQPYGMGGLGSLGNTY GGYYYSGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGVNVALFIL YMAAAIVYVNDTNRGGLCYYPLFNTPMNAMFCRVEGGQIAAMIFLFVTMIVYLVSALVCL KLWRHEAARRHREFLEQQEINDPSLSSKRKMCEAAISDRQRDQEVNVKDLRTTTKMTPEL LSGHIPPGHIPKPIVMPDYVAKYPVIQTDDDRERYKAVFQDQFSEYKELSAEVQAILRKF DELDTVMSRLPHHSENRQEHERISRIHEEFRKKKNDPSFLEKKERCDYLKNKLSHIKQRI QEYDKVMNWDTQGYP
Uniprot No.

Target Background

Function
Plays a crucial role in the formation of tricellular tight junctions and epithelial barriers. It is essential for normal hearing, contributing to the separation of the endolymphatic and perilymphatic spaces of the organ of Corti in the inner ear and supporting the survival of hair cells in the organ of Corti.
Gene References Into Functions
  1. Research suggests that both tricellular tight junctions proteins TRIC and LSR are critical for the survival of differentiated cochlear cells. PMID: 28767685
  2. Tricellulin acts as a specific redox sensor and sealing element at 3-cell contacts, potentially compensating as a redox mediator for occludin loss at 2-cell contacts in vivo and in vitro. PMID: 25919114
  3. GFP-tagged angulin-1/LSR, with serine 288 substituted by alanine, showed dispersed localization to bicellular junctions, indicating that phosphorylation of Ser288 is essential for the exclusive localization of angulin-1/LSR and tricellulin at tTJs. PMID: 24889144
  4. In vivo studies have demonstrated the localization of angulin-1/LSR and tricellulin at tricellular contacts of brain and retinal endothelial cells. PMID: 24212375
  5. The absence of tricellulin prevented the fusion of bicellular junction strands with the central element of the tricellular junction in the inner ear epithelia. PMID: 23979167
  6. Tricellulin may be a critical component in maintaining the integrity of PNS myelin function and morphology. PMID: 21097846
  7. This study identified tricellulin as the first integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts. PMID: 16365161
  8. In the inner ear, tricellulin is concentrated at the tricellular tight-junctions in cochlear and vestibular epithelia, including the structurally complex and extensive junctions between supporting and hair cells. PMID: 17186462
  9. Knockdown of occludin resulted in the mislocalization of tricellulin to bTJs, suggesting that occludin supports tricellular localization of tricellulin by preventing its presence at bicellular tight junctions. PMID: 18768749

Show More

Hide All

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Tissue Specificity
Detected in small intestine, stomach and kidney, in epithelial cells. Detected in pancreas, retina and lung, and in stria vascularis, utricle and the organ of Conti in the inner ear (at protein level). Predominantly detected in small intestine, lung and k

Q&A

What structural features make MARVELD2 essential for epithelial barrier integrity?

The MARVELD2-encoded tricellulin contains two conserved domains critical for function:

  • A four-transmembrane domain facilitating integration into plasma membranes

  • A C-terminal occludin-ELL domain (Pfam PF07303) mediating interactions with ZO-1 scaffolding proteins

Methodological insight: Confirming domain functionality requires:

  • Site-directed mutagenesis of putative interaction residues (e.g., Trp221 in occludin-ELL domain )

  • Co-immunoprecipitation assays using ZO-1 transfection vectors

  • Transepithelial electrical resistance (TEER) measurements in MDCK-II cells with/without MARVELD2 knockout

How do researchers validate MARVELD2 expression in murine models?

Three complementary approaches provide validation:

  • Quantitative RT-PCR with primers spanning exons 2-4 (NM_001038603.3 transcript )

  • Western blotting using antibodies against the N-terminal epitope (aa 50-150) to avoid cross-reactivity with MARVELD1

  • Immunofluorescence localization in organ of Corti whole mounts using confocal microscopy

Key validation data from NSHL studies:

TechniqueTargetFindings in MARVELD2 MutantsSource
Sanger sequencingc.663G>APremature stop at Trp221 (60.4% truncation)
I-TASSER modelingOccludin-ELL domainΔG stability change: -2.3 kcal/mol
TEER assayMDCK monolayers42% reduction vs wild-type

What strategies resolve contradictory permeability data across MARVELD2 studies?

Discrepancies in epithelial leakage assays often stem from:

Technical variables

  • Cell type differences (renal vs. intestinal epithelium)

  • Calcium concentration in culture media (1.8 mM optimal)

  • Timepoint selection (barrier maturation peaks at 72h post-confluence)

Biological factors

  • Compensatory upregulation of claudin-15 in knockout models

  • Strain-specific background mutations (C57BL/6 vs. BALB/c mice)

Solution protocol:

  • Perform isogenic cell line comparisons using CRISPR/Cas9-edited clones

  • Incorporate dual-radiolabeled tracer assays (3H-mannitol + 14C-PEG4000)

  • Apply computational fluid dynamics to microfluidic barrier models

How to design a MARVELD2 mutation study that distinguishes between dominant-negative and loss-of-function effects?

A three-phase approach isolates mutation mechanisms:

Phase 1: Structural impact prediction

  • Use RoseTTAFold for ΔΔG calculations on mutant vs wild-type

  • Perform molecular dynamics simulations of truncated proteins (e.g., p.Trp221* )

Phase 2: In vitro oligomerization assays

  • Blue native PAGE of HEK293T lysates co-expressing FLAG/HA-tagged variants

  • FRET efficiency measurements between C-terminal domains

Phase 3: In vivo rescue experiments

  • Generate conditional knock-in mice with Tet-On regulated wild-type MARVELD2

  • Compare cochlear histology at P15 (peak hair cell maturation) using:

    • Scanning electron microscopy of stereocilia bundles

    • ABR threshold shifts across 8-32kHz frequencies

What controls are essential when quantifying tricellulin recruitment to tricellular junctions?

A nested control system eliminates false positives:

Control TierPurposeImplementation
PrimaryEquipment calibrationAlexa Fluor 488-conjugated 10nm gold beads in Matrigel phantom
SecondaryStaining specificityMARVELD2 siRNA knockdown + isotype antibody control
TertiaryBiological variabilityTriplicate samples across 3 estrous cycle stages (proestrus, estrus, metestrus)

How to troubleshoot low yield in recombinant mouse MARVELD2 purification?

Modify the standard protocol as follows:

Expression system optimization

  • Switch from HEK293 to Sf9 insect cells (enhanced post-translational modification)

  • Add 2mM sodium butyrate 24h post-transection to boost protein yield

Chromatography adjustments

StepProblemSolution
AffinityProteolytic cleavageInclude 1mM PMSF + EDTA-free protease inhibitor cocktail
Ion exchangeAggregate formationPre-treat with 0.01% n-dodecyl β-D-maltoside (DDM)
Size exclusionLow recoveryUse Superdex 200 Increase 10/300 GL column at 0.3mL/min flow rate

What statistical models best analyze MARVELD2 mutation penetrance in breeding colonies?

Apply a mixed-effects model accounting for:

Fixed effects

  • Genotype (homozygous vs heterozygous)

  • Gender (account for X-linked modifiers)

Random effects

  • Litter size (3-8 pups typical)

  • Maternal microbiome profile (16S rRNA sequencing quartiles)

Equation
P(hearing loss)=11+e(β0+β1Genotype+β2Gender+uLitter)P(hearing\ loss) = \frac{1}{1 + e^{-(\beta_0 + \beta_1Genotype + \beta_2Gender + uLitter)}}

Where uLitterN(0,σ2)uLitter \sim \mathcal{N}(0, \sigma^2) represents litter-specific variability .

How to reconcile transcriptomic vs proteomic MARVELD2 expression data?

A tiered normalization approach resolves platform discrepancies:

  • Batch correction

    • ComBat algorithm for microarray/RNA-seq data

    • TMT-based internal standards in mass spectrometry

  • Cross-platform alignment

    • Anchor gene set: ACTB, GAPDH, RPLP0 (variance-stabilized counts)

    • Penalized regression model:
      Proteomic intensity=α+β(Transcript count)0.67+ϵProteomic\ intensity = \alpha + \beta(Transcript\ count)^{0.67} + \epsilon

  • Pathway enrichment validation

    • Require FDR <0.1 in both platforms for tight junction pathways

What single-cell approaches map MARVELD2 expression dynamics in cochlear development?

A 10x Genomics Chromium-based workflow:

Day 0-5

  • Dissociate P1 mouse cochleae into 5000 live cells/sample

Day 6-7

  • Library prep with Smart-seq2 for full-length transcripts

Analysis pipeline

  • Cell Ranger 7.1 for alignment (mm39 reference)

  • SCENIC for regulon analysis of MARVELD2 co-expressed genes

Critical parameters:

  • Minimum 50,000 reads/cell

  • Doublet rate <5% (demuxlet verification)

How to engineer a MARVELD2 reporter mouse for in vivo barrier imaging?

Stepwise CRISPR knock-in strategy:

  • Insert T2A-mNeonGreen cassette before stop codon in exon 7

  • Validate with:

    • Southern blot (5' probe: chr5:69444300-69444500 )

    • Light sheet microscopy of intestinal crypts

Expected expression pattern:

TissueSignal IntensityLocalization
Cochlea+++Tricellular junctions
Colon++Crypt basement membrane
Kidney+Distal tubule junctions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.