Recombinant Mouse MARVEL domain-containing protein 3 (Marveld3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Marveld3; MARVEL domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Marveld3
Target Protein Sequence
MKNTSGHREPRTRPRERDPDRRPHPDRDHHVERSRDRGGDRHRERNGDVRGNGDRRAGRE QRTDRDQRQDRHRDAGHRASEQRALEKSRQSRARPEPWGPSWDAAPTPGPAPWGPRELSQ KHGLGRRGLESERASERYVPTYSVPALQEEEYYQSEAEGLLDCHKCRYLCTGRACWQMLK ALLNLLILACSSVSYNSTGGYTGITSLGGIYYYQYGGAYSGFDGADGERAQQLDVQFYQL KLPTVTAAMAYSGALMTFSCLTLLAGALRVPWHCPLWLVIEGLMDALIAGAYVPGLYFFF QHLSAAYSSDVCKERETLYQSKGYSGFNCGVHGGDIGAGVFAAMAIGVFAVGAVLAFRGY RKVKKLKEKPTEMLEF
Uniprot No.

Target Background

Function
As a component of tight junctions, MARVELD3 plays a crucial role in regulating paracellular ion conductivity.
Gene References Into Functions
  1. MarvelD3, occludin, and tricellulin constitute the tight junction-associated MARVEL protein family. PMID: 20164257
Database Links

KEGG: mmu:73608

UniGene: Mm.86833

Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, tight junction.
Tissue Specificity
Widely expressed with highest levels in small intestine, colon, stomach and lung. Liver expresses only isoform 2.

Q&A

What is the basic structure and function of MarvelD3?

MarvelD3 is a four-span transmembrane protein whose predicted transmembrane helices form a MARVEL domain, a structural motif originally discovered in proteins involved in membrane apposition and fusion events. In mammals, MarvelD3 is expressed as two alternatively spliced isoforms with broad tissue distribution in various epithelial and endothelial cells .

Functionally, MarvelD3 is a component of bicellular tight junctions where it co-localizes with occludin. It contributes to the regulation of the paracellular barrier, although its expression is not essential for the formation of functional tight junctions. Interestingly, RNA interference experiments in Caco-2 cells have shown that MarvelD3 depletion results in monolayers with increased transepithelial electrical resistance, indicating its role as a determinant of paracellular permeability .

How does MarvelD3 differ from other tight junction-associated MARVEL proteins?

MarvelD3, occludin, and tricellulin comprise the tight junction-associated MARVEL protein (TAMP) family. While these proteins share structural similarities and all contain the MARVEL domain, they exhibit distinct but overlapping functions:

TAMP MemberPrimary LocalizationFunctionCompensation
MarvelD3Bicellular tight junctionsRegulates paracellular permeability and signalingCan partially compensate for occludin or tricellulin loss
OccludinBicellular tight junctionsInvolved in barrier regulation and signalingCannot fully compensate for MarvelD3 loss
TricellulinPrimarily at tricellular tight junctionsEssential for tricellular junction integrityCannot fully compensate for MarvelD3 loss

Phylogenetic analyses reveal that these proteins are evolutionarily related but have diverged to serve specialized functions. While MarvelD3 may partially compensate for occludin or tricellulin loss, it is insufficient to fully restore function in the absence of other TAMPs . Studies suggest these proteins should be considered as a group with parallel, but nonredundant, functions at tight junctions .

What is the tissue expression profile of MarvelD3 compared to other TAMPs?

MarvelD3 exhibits a broad tissue distribution pattern that partially overlaps with but is distinct from other TAMP family members. Reanalysis of tissue expression profile databases using the updated annotation file for the Affymetrix Mouse Genome 430 2.0 Array revealed specific expression patterns for MarvelD3 .

Both MarvelD3 isoforms are expressed by different types of epithelial cells (including intestinal and corneal epithelia) as well as endothelial cells. This broad distribution suggests that MarvelD3 serves important functions across various tissue types . Comparative analysis across tissues shows that while all three TAMPs (MarvelD3, occludin, and tricellulin) are often co-expressed, their relative abundance varies, potentially reflecting tissue-specific functional requirements for tight junction composition and regulation .

How does MarvelD3 regulate the MEKK1-JNK signaling pathway in epithelial cells?

MarvelD3 serves as a dynamic junctional regulator of the MEKK1–c-Jun NH2-terminal kinase (JNK) pathway, with expression levels inversely correlating with JNK activity. Mechanistically, MarvelD3 recruits MEKK1 to tight junctions, resulting in down-regulation of JNK phosphorylation and inhibition of JNK-regulated transcriptional mechanisms .

This regulatory function has significant implications for cellular behavior:

  • In differentiating Caco-2 cells, loss of MarvelD3 expression leads to increased cell migration and proliferation.

  • Conversely, reexpression of MarvelD3 in metastatic tumor cell lines inhibits migration, proliferation, and in vivo tumor formation.

  • During osmotic stress, the interplay between MarvelD3 internalization and JNK activation fine-tunes MEKK1 activation, affecting junction integrity and cell survival .

Researchers investigating this pathway should consider dual immunofluorescence approaches to visualize the localization of MarvelD3 and phosphorylated JNK, combined with co-immunoprecipitation assays to detect direct interactions between MarvelD3 and MEKK1. Phosphorylation-specific antibodies are essential for monitoring JNK activation status in response to MarvelD3 manipulation .

What methodological approaches are most effective for studying MarvelD3 function in vitro?

Several complementary methodological approaches have proven effective for investigating MarvelD3 function:

  • RNA Interference: siRNA knockdown in epithelial cell lines (particularly Caco-2 cells) has been instrumental in revealing MarvelD3's role in tight junction function . This approach should include verification of knockdown efficiency using qRT-PCR and western blotting.

  • Barrier Function Assays: Transepithelial electrical resistance (TEER) measurements and paracellular tracer flux assays using fluorescently labeled dextrans of various sizes help quantify the impact of MarvelD3 on barrier properties .

  • Recombinant Protein Expression: For structure-function analyses, expression of recombinant MarvelD3 in heterologous systems can be coupled with domain deletion/mutation studies to identify critical functional regions.

  • Live Cell Imaging: FRAP (Fluorescence Recovery After Photobleaching) and similar techniques can assess the dynamic behavior of fluorescently tagged MarvelD3 at tight junctions .

  • Co-immunoprecipitation and Proximity Ligation Assays: These techniques are valuable for identifying protein-protein interactions between MarvelD3 and potential signaling partners like MEKK1 .

When designing experiments, researchers should account for potential compensatory mechanisms from other TAMP family members by considering combinatorial knockdown approaches or using cell lines with differing endogenous expression levels of TAMPs.

What is the role of MarvelD3 in epithelial-mesenchymal transition and cancer progression?

MarvelD3 appears to function as a tumor suppressor in certain contexts, with its loss correlating with cancer progression. In hepatocellular carcinoma (HCC), MarvelD3 expression is significantly downregulated, and this downregulation correlates with tumor stage and progression .

Mechanistically, MarvelD3 inhibits epithelial-mesenchymal transition (EMT) and migration of HCC cells through:

  • Inhibition of the NF-κB signaling pathway, a key regulator of EMT

  • Counteracting transforming growth factor β1 (TGF-β1) and Snail/Slug-induced EMT

  • Suppression of matrix metallopeptidase 9 (MMP9) expression, which is involved in extracellular matrix degradation during invasion

Research methodologies to study MarvelD3's role in cancer should include:

  • Analysis of clinical specimens to correlate MarvelD3 expression with patient outcomes

  • Stable overexpression and knockdown systems in cancer cell lines

  • Migration and invasion assays (scratch wound, transwell)

  • Assessment of EMT markers (E-cadherin, N-cadherin, vimentin) by immunoblotting and immunofluorescence

  • In vivo xenograft models to evaluate tumor formation and metastatic potential

The finding that high expression of MARVELD3 may serve as a potential prognostic biomarker underscores its clinical relevance in cancer research .

How can researchers effectively analyze protein-protein interactions involving MarvelD3?

Investigating protein-protein interactions (PPIs) involving MarvelD3 requires a multi-faceted approach:

  • Bioinformatic Analysis: Utilize databases like STRING (https://cn.string-db.org/) and GeneMANIA (http://genemania.org) to predict potential interaction partners based on co-expression patterns and functional similarities .

  • Co-immunoprecipitation (Co-IP): This remains the gold standard for validating direct protein interactions. For MarvelD3, special attention should be paid to detergent selection during cell lysis to preserve membrane protein interactions. Protocols using digitonin or mild non-ionic detergents have proven effective .

  • Proximity Ligation Assay (PLA): This technique can visualize protein interactions in situ with high sensitivity, particularly valuable for detecting transient interactions between MarvelD3 and signaling molecules.

  • FRET/BRET Analysis: These techniques can reveal dynamic interactions in living cells by measuring energy transfer between fluorophore-tagged proteins.

  • Domain Mapping: Using truncation mutants of MarvelD3 can identify specific interaction domains. For instance, the cytoplasmic N-terminal domain of MarvelD3 has been implicated in interactions with the MEKK1-JNK pathway components .

Analysis of MarvelD3-related gene function can be further enhanced through Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) analyses using R packages (org.Hs.eg.db and clusterProfiler) to identify enriched biological processes and signaling pathways .

What are the current challenges in generating functional recombinant mouse MarvelD3 protein?

Production of functional recombinant mouse MarvelD3 presents several technical challenges:

  • Membrane Protein Expression: As a four-span transmembrane protein, MarvelD3 is difficult to express in soluble form. Expression systems like insect cells (Sf9, High Five) or mammalian cells (HEK293) are preferred over bacterial systems for proper folding and post-translational modifications.

  • Protein Solubilization: Extraction of MarvelD3 from membranes requires careful detergent selection. Detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) have proven effective for similar membrane proteins while maintaining native structure.

  • Maintaining Protein Stability: The MARVEL domain structure is sensitive to denaturation during purification. Inclusion of stabilizing agents like cholesterol or specific lipids in purification buffers can help maintain the native conformation.

  • Alternative Approaches: For functional studies, researchers may consider:

    • Fusion constructs with soluble tags (MBP, SUMO) to enhance solubility

    • Nanodiscs or amphipols to provide a membrane-like environment

    • Cell-free expression systems with supplied lipids

  • Verification of Functionality: Recombinant MarvelD3 should be validated for proper folding and function through:

    • Circular dichroism to assess secondary structure

    • Binding assays with known interaction partners (e.g., components of the MEKK1 pathway)

    • Incorporation into artificial membrane systems to assess barrier function

What are the optimal conditions for studying MarvelD3 localization and dynamics at tight junctions?

Studying MarvelD3 localization and dynamics requires careful experimental design:

  • Cell Models: Polarized epithelial cell lines (Caco-2, MDCK, or corneal epithelial cells) grown on permeable supports are ideal systems as they form well-defined tight junctions . Primary mouse intestinal organoids offer a more physiologically relevant 3D model system.

  • Immunofluorescence Optimization:

    • Fixation: 4% paraformaldehyde (10 minutes) preserves tight junction structure

    • Permeabilization: 0.2% Triton X-100 (10 minutes) for adequate antibody access

    • Antibody selection: Use validated antibodies against both N-terminal and C-terminal domains of MarvelD3

    • Co-staining with ZO-1 or occludin as tight junction markers for reference

  • Live-Cell Imaging:

    • Stable expression of fluorescently tagged MarvelD3 (e.g., MarvelD3-GFP) at near-endogenous levels

    • Spinning disk confocal microscopy with controlled temperature (37°C) and CO₂ (5%)

    • Acquisition parameters: minimum laser power to avoid phototoxicity, 5-10 second intervals for dynamics studies

  • FRAP Analysis Parameters:

    • Bleach region: 2-5 μm² area of junction

    • Bleach settings: 80-100% laser power for 1 second

    • Recovery monitoring: 30-60 seconds pre-bleach, 5-10 minutes post-bleach

    • Analysis: mobile fraction calculation and half-time of recovery

  • Calcium Switch Assay: This technique allows for synchronized tight junction disassembly/reassembly by calcium depletion/repletion, providing insights into MarvelD3 recruitment during junction formation .

These methodologies should be combined with functional assays like TEER measurements to correlate MarvelD3 dynamics with barrier properties.

How can researchers effectively analyze MarvelD3 regulation during epithelial stress response?

Analyzing MarvelD3's role in epithelial stress response requires methodologies that capture both acute and chronic adaptations:

  • Osmotic Stress Models:

    • Acute hyperosmotic stress: 600 mOsm/kg using NaCl or sorbitol addition

    • Monitoring MarvelD3 internalization via time-lapse imaging of fluorescently tagged protein

    • Assessment of junction integrity using TEER measurements and paracellular flux assays

    • Quantification of JNK phosphorylation status and cell survival

  • Oxidative Stress Protocols:

    • H₂O₂ treatment (0.1-1 mM) for acute oxidative stress

    • Analysis of MarvelD3 expression, localization, and phosphorylation status

    • Assessment of tight junction protein complex composition changes using BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis)

  • Cytokine Treatment:

    • TNF-α and IFN-γ treatment to mimic inflammatory conditions

    • qPCR and western blot analysis of MarvelD3 expression

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors regulating MarvelD3 during stress

  • In Vivo Stress Models:

    • DSS-induced colitis in mice to assess intestinal barrier stress

    • Tissue-specific conditional knockout models using Cre-loxP system

    • Immunohistochemical analysis of MarvelD3 expression and localization in stressed tissues

  • Signaling Pathway Analysis:

    • Pharmacological inhibitors of MEKK1-JNK pathway (SP600125 for JNK inhibition)

    • Time-course analysis of signaling cascade activation

    • Co-immunoprecipitation to track dynamic protein-protein interactions during stress response

When analyzing stress responses, it's crucial to include time-course experiments that capture both immediate (minutes to hours) and adaptive (hours to days) responses, as MarvelD3 function appears to involve dynamic trafficking between junctional and intracellular pools .

How should researchers interpret contradictory findings regarding MarvelD3 function across different cell types?

Interpretation of contradictory findings regarding MarvelD3 requires careful consideration of several factors:

  • Cell Type-Specific Context:

    • Different epithelial cells have unique tight junction composition and signaling networks

    • Expression levels of other TAMPs may compensate for MarvelD3 loss in certain cell types

    • Tissue-specific binding partners may alter MarvelD3 function

  • Experimental Approach Considerations:

    • Transient vs. stable knockdown/overexpression (acute vs. chronic adaptation)

    • 2D monolayers vs. 3D organoid models (different polarization states)

    • Immortalized cell lines vs. primary cells (altered signaling pathways)

  • Analytical Framework:

    • Create comparative tables of findings across cell types with standardized parameters

    • Perform meta-analysis when sufficient quantitative data is available

    • Use systematic classification of outcomes based on cell origin (embryonic lineage)

  • Reconciliation Strategies:

    • Identify common molecular mechanisms amid phenotypic differences

    • Determine if discrepancies reflect different aspects of a unified biological role

    • Consider that opposing findings might represent context-dependent functions

For example, while MarvelD3 depletion in Caco-2 cells increases transepithelial electrical resistance , its role may differ in hepatocellular carcinoma cells where it regulates EMT and NF-κB signaling . These seemingly contradictory findings likely reflect the diverse functions of MarvelD3 in different cellular contexts and its involvement in multiple signaling pathways.

What bioinformatic approaches are recommended for analyzing MarvelD3 sequence conservation and evolutionary relationships?

For comprehensive bioinformatic analysis of MarvelD3, researchers should employ the following approaches:

  • Sequence Alignment Optimization:

    • Use the E-INS-i algorithm in the MAFFT package, which is particularly effective for highly divergent sequences with conserved domains like the MARVEL domain

    • Apply PolyPhobius or TMHMM packages for transmembrane topology prediction, with preference for PolyPhobius due to its superior performance with eukaryotic proteins

  • Phylogenetic Analysis:

    • Employ ProtTest to identify the optimal evolutionary model for MarvelD3 sequences

    • Use maximum likelihood methods (RAxML, PhyML) for tree reconstruction

    • Implement Bayesian approaches (MrBayes) for confidence assessment

    • Incorporate synteny analysis to evaluate genomic context conservation

  • Functional Domain Prediction:

    • Apply the SMART (Simple Modular Architecture Research Tool) database to identify conserved domains

    • Use Jalview for conservation mapping onto multiple sequence alignments

    • Implement ConSurf for evolutionary conservation analysis mapped to predicted 3D structures

  • Structural Bioinformatics:

    • Apply homology modeling using related membrane protein structures as templates

    • Validate models using PROCHECK or MolProbity

    • Perform molecular dynamics simulations to assess stability of predicted structures in membrane environments

  • Expression Correlation Analysis:

    • Reanalyze expression databases using updated annotation files (e.g., Mouse4302_Mm_ENSG)

    • Apply GCRMA and Bioconductor for normalization and statistical analysis

    • Implement co-expression network analysis to identify functionally related genes

These approaches should be integrated to develop a comprehensive understanding of MarvelD3 evolution and function, particularly in relation to other TAMP family members.

What are the emerging therapeutic opportunities targeting MarvelD3 in disease contexts?

Several emerging therapeutic opportunities targeting MarvelD3 are being explored:

  • Cancer Therapeutics:

    • The tumor suppressive role of MarvelD3 in hepatocellular carcinoma suggests potential for restoration therapy approaches

    • High expression of MARVELD3 as a prognostic biomarker opens possibilities for stratification of patients for targeted therapies

    • Targeting the MarvelD3-regulated MEKK1-JNK pathway could provide new avenues for cancer treatment

  • Barrier Function Modulation:

    • As a regulator of paracellular permeability, MarvelD3 represents a potential target for modulating epithelial and endothelial barriers

    • This could have applications in inflammatory conditions with barrier dysfunction

    • Targeting MarvelD3 trafficking might allow temporal control of barrier properties

  • Methodological Approaches:

    • Gene therapy approaches for MarvelD3 restoration in cancers with reduced expression

    • Small molecule screening to identify compounds that stabilize MarvelD3 at tight junctions

    • Peptide mimetics targeting MarvelD3-interaction domains to modulate signaling

    • Antibody-based therapies to alter MarvelD3 function or target cells based on MarvelD3 expression

  • Diagnostic Applications:

    • Development of tissue-specific MarvelD3 expression profiles as diagnostic tools

    • Integration of MarvelD3 status into multi-biomarker panels for cancer prognosis

    • Imaging approaches targeting MarvelD3 for visualization of tight junction integrity

What future research directions will advance our understanding of MarvelD3 function?

Future research on MarvelD3 should focus on several promising directions:

  • Structural Studies:

    • Cryo-EM or X-ray crystallography of MarvelD3 alone and in complex with interaction partners

    • Structural comparison with other TAMP family members to identify unique features

    • Development of structure-based models of MarvelD3 function in tight junction assembly

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, phosphoproteomics) to map MarvelD3-dependent networks

    • Single-cell analysis to reveal cell-to-cell variability in MarvelD3 function

    • Mathematical modeling of MarvelD3 dynamics during junction assembly/disassembly

  • Advanced Imaging Techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize MarvelD3 nanoscale organization

    • Correlative light and electron microscopy to link function to ultrastructure

    • Intravital imaging to monitor MarvelD3 dynamics in vivo

  • Disease Relevance Studies:

    • Comprehensive analysis of MarvelD3 mutations/variants in human diseases

    • Development of tissue-specific knockout models to assess physiological roles

    • Investigation of MarvelD3 in additional cancer types and epithelial disorders

  • Therapeutic Development:

    • High-throughput screens for compounds modulating MarvelD3 expression or function

    • Development of targeted delivery systems for MarvelD3-based therapeutics

    • Exploration of combinatorial approaches targeting multiple tight junction components

These research directions should prioritize integration of findings across different experimental systems and disease contexts to develop a unified understanding of MarvelD3 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.