Recombinant Mouse Mas-related G-protein coupled receptor member A1 (Mrgpra1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

Key Biological Functions

  • Pain and Itch Modulation: Activated by bilirubin and RFamide peptides, triggering calcium signaling in sensory neurons . Knockout mice show reduced scratching responses to pruritogens .

  • Immune Regulation: Upregulated in inflammatory conditions (e.g., lung fibrosis, dermatitis) and interacts with mast cells to mediate histamine-independent inflammation .

  • Orphan Receptor Pharmacology: Binds structurally diverse ligands, including chemokines like CXCL14, via a proposed multi-agonist binding pocket .

Mechanistic Insights

  • Calcium Flux: Ligand binding induces Gαq-mediated PLC activation, increasing intracellular Ca²⁺ .

  • Pathway Crosstalk: MRGPRA1 activation inhibits TRPA1 channels, modulating nociceptive neuron excitability .

Research Applications and Experimental Data

Experimental Models

  • In Vitro Systems: HEK293 cells expressing MRGPRA1 used for calcium imaging and GTPγS binding assays .

  • Animal Studies: Mrgpra1⁻/⁻ mice exhibit attenuated itch responses to bilirubin and FMRF-amide .

Key Findings

Study FocusResultCitation
Bilirubin-Induced ItchMRGPRA1 mediates 75% of scratching behavior in wild-type mice
CXCL14 InteractionActivates human ortholog MRGPRX2 (EC₅₀ = 0.89 µM) in mast cells
RFamide SpecificityFLRF-amide shows higher potency than FMRF-amide

Therapeutic Implications

  • Inflammatory Diseases: Targeting MRGPRA1 may alleviate pruritus in cholestasis or atopic dermatitis .

  • Drug Development: High-throughput screens using recombinant MRGPRA1 identify antagonists for pain management .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mrgpra1; Mrga1; Mas-related G-protein coupled receptor member A1; RF-amide G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mrgpra1
Target Protein Sequence
MDNTIPGGINITILIPNLMIIIFGLVGLTGNGIVFWLLGFCLHRNAFSVYILNLALADFF FLLGHIIDSILLLLNVFYPITFLLCFYTIMMVLYIAGLSMLSAISTERCLSVLCPIWYHC HRPEHTSTVMCAVIWVLSLLICILNSYFCGFLNTQYKNENGCLALNFFTAAYLMFLFVVL CLSSLALVARLFCGTGQIKLTRLYVTIILSILVFLLCGLPFGIHWFLLFKIKDDFHVFDL GFYLASVVLTAINSCANPIIYFFVGSFRHRLKHQTLKMVLQNALQDTPETAKIMVEMSRS KSEP
Uniprot No.

Target Background

Function
Mas-related G-protein coupled receptor member A1 (Mrgpra1) is an orphan receptor activated by certain RFamide-family neuropeptides, such as FLRF-amide and FMRF-amide. It mediates its effects through G protein coupling, activating a phosphatidylinositol-calcium second messenger system. This action is mediated by Gq and G11 proteins. Mrgpra1 may regulate nociceptive neuron function and modulate pain perception.
Gene References Into Functions
  1. Substance P activates Mrgpra1 on sensory neurons, rather than NK-1R, to induce itch. PMID: 28219706
  2. Mrgpra1 is activated by RF-amide-related peptides via the Gαq/11 pathway. PMID: 12397184
Database Links
Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons that includes nociceptors. Expressed in the subclass of non-peptidergic sensory neurons that are IB4(+) and VR1(-).

Q&A

What is Mrgpra1 and what is its expression pattern in mice?

Mrgpra1 (Mas-related G-protein coupled receptor member A1) was first identified through its 35% sequence homology with the known angiotensin receptor Mas1 . Using in situ hybridization techniques, Mrgpra1 was discovered to be expressed in a subset of nociceptors in mouse dorsal root ganglia (DRG) and trigeminal ganglia (TG), confirming its potential role in sensory neuron function . Despite early reports suggesting limited expression in adult mice, more recent studies demonstrate that Mrgpra1 is indeed expressed in the DRG, skin, trigeminal ganglion, and spinal cord in adult mice .

The initial characterization using in situ hybridization may have lacked sensitivity for detecting lower expression levels in mature animals, but functional studies corroborate the presence of active receptors in adult mice . Adult mice demonstrate scratching behavior after treatment with the Mrgpra1 agonist FMRF, providing functional evidence of receptor expression . Critical genetic evidence further supports the receptor's physiological relevance, as Mrgpra1-knockout mice scratch significantly less than wild-type mice in response to pruritogenic stimuli .

What signaling pathways does Mrgpra1 activate?

Mrgpra1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system . The receptor's effect is primarily mediated through Gq and G11 proteins, connecting receptor activation to downstream calcium signaling pathways essential for neuronal activation . When stimulated by agonists such as RF-amide-related peptides or FMRF-amide, Mrgpra1 initiates this signaling cascade that ultimately results in neuronal excitation .

The downstream consequences of this signaling are particularly relevant in nociceptive neurons, where Mrgpra1 activation may regulate neuronal function by modulating pain perception . In the context of itch sensation, this Gq/G11-mediated signaling leads to neuronal activation that ultimately manifests as scratching behavior in mice, demonstrating the functional relevance of this pathway in pruriception .

What is the relationship between Mrgpra1 and bilirubin in itch sensation?

Bilirubin has been identified as an endogenous activator of Mrgpra1, establishing a direct molecular link between cholestasis (where bilirubin levels are elevated) and pruritus . Studies have demonstrated that bilirubin can bind to and activate Mrgpra1, promoting itch in mice . This finding is particularly significant as it provides a molecular explanation for cholestatic pruritus, a common symptom in liver diseases associated with elevated bilirubin levels.

In experimental models, subcutaneous injection of bilirubin induces scratching behavior in wild-type mice, but this response is significantly reduced in Mrgpra1-knockout mice . Furthermore, in mouse models of cholestasis induced by α-naphthyl isothiocyanate (ANIT) and cyclosporin, spontaneous itch is significantly reduced in Mrgpra1-knockout mice . This reduction in itch behavior is also observed in knockout mice lacking biliverdin reductase (Bvr), the key biosynthetic enzyme for bilirubin, further supporting the bilirubin-Mrgpra1 signaling axis in itch sensation .

How does mouse Mrgpra1 compare to human MRGPR receptors?

Mouse Mrgpra1 lacks a direct one-to-one ortholog in humans, which complicates translational research in this area . The human genome contains eight intact Mrgprs, with four genes (MRGPRX1-X4) showing sequence similarity to the murine MrgprA subfamily, but without clear homology between individual receptors . This divergence reflects the rapid evolution of these receptors and suggests possible species-specific adaptations in itch and pain sensation pathways.

Human MRGPRX4 has been implicated in cholestatic pruritus, potentially serving a similar function to mouse Mrgpra1 in this context . Similarly, MRGPRX1 is recognized as a key receptor for itch perception in humans . The functional homologs of human MRGPRX1 in mice appear to be primarily MrgprA3 and MrgprC11, which link to TRPA1 through different mechanisms to mediate itch sensation . Whereas MrgprC11 connects to TRPA1 through Gq-PLC signaling, MrgprA3 links to TRPA1 through Gβγ subunits . These differences highlight the complexity of itch signaling mechanisms across species.

What structural features characterize the Mrgpr family receptors?

While specific structural data for mouse Mrgpra1 is limited in the provided search results, insights can be gleaned from studies of related receptors, particularly human MRGPRX1. Cryo-EM structures of MRGPRX1 complexes reveal a shallow orthosteric pocket with conformational plasticity that allows for the sensing of multiple different peptidic itch allergens . This structural characteristic likely plays a crucial role in the receptor's ability to respond to diverse pruritogenic compounds.

The binding modes of peptide agonists in MRGPRX1 are distinct from those of MRGPRX2, with peptides binding in a reversed orientation . Specifically, in MRGPRX1, peptide ligands like BAM8-22 and CNF-Tx2 bind starting from TM5-TM6 at the N-terminus and reach TM4 at the C-terminus, whereas in MRGPRX2, ligands start from TM4 and reach to TM1 and TM2 . MRGPRX1 contains a unique pocket feature at the extracellular ends of TM3 and TM4 that accommodates the peptide C-terminal "RF/RY" motif, which could serve as a key mechanism for peptidic allergen recognition .

What are optimal techniques for detecting Mrgpra1 expression?

Researchers studying Mrgpra1 should consider employing multiple complementary techniques to accurately characterize its expression patterns. While early studies utilized in situ hybridization, this method lacks sensitivity for detecting lower expression levels, particularly in adult mice . More recent investigations have successfully detected Mrgpra1 expression in adult mouse DRG, skin, trigeminal ganglion, and spinal cord using more sensitive molecular techniques .

For comprehensive expression analysis, a combination of RT-PCR for transcript detection, immunohistochemistry for protein localization (with validated antibodies), and functional calcium imaging in response to Mrgpra1 agonists like FMRF provides the most complete characterization . Additionally, single-cell RNA sequencing can offer insights into the specific neuronal subpopulations expressing Mrgpra1, which is particularly valuable given its restricted expression pattern in sensory neurons. Genetic approaches using reporter mice (where fluorescent proteins are expressed under the Mrgpra1 promoter) can also provide spatial and temporal information about expression patterns in vivo.

What considerations are important when working with recombinant Mrgpra1 protein?

Recombinant Mrgpra1 protein requires special handling considerations due to its nature as a transmembrane protein . The protein is typically expressed in cell-free expression systems to maintain proper folding and functionality . Researchers should be aware that small volumes of Mrgpra1 recombinant protein vials may occasionally become entrapped in the seal of the product vial during shipment and storage, necessitating careful opening and inspection .

For functional studies, reconstitution into appropriate lipid environments or detergent micelles is critical to maintain the native conformation and activity of the receptor. When designing experiments with recombinant Mrgpra1, researchers should consider its stability under various buffer conditions, temperature sensitivity, and potential for aggregation. Validation of protein activity using known agonists such as RF-amide peptides should be performed before experimental use. For long-term storage, appropriate cryopreservation techniques should be employed to maintain protein integrity and functionality.

What functional assays are most effective for studying Mrgpra1 activation?

Multiple complementary assays can effectively assess Mrgpra1 activation in different experimental contexts:

Assay TypeMeasurementAdvantagesLimitations
Calcium imagingIntracellular Ca²⁺ fluxDirect visualization of neuronal activation; single-cell resolutionRequires fluorescent indicators; temporal limitations
GPCR signaling assaysIP₃/DAG production; cAMP levelsDirectly measures G-protein pathway activationLess spatial information; may require cell populations
ElectrophysiologyMembrane currents and potentialsHigh temporal resolution; direct measure of neuronal activityTechnical complexity; lower throughput
Behavioral assaysScratching behavior in miceMost physiologically relevant; measures integrated responseIndirect measure of receptor activation; complex interpretation

For in vitro studies, calcium imaging using fluorescent indicators provides direct visualization of Mrgpra1 activation in sensory neurons, especially since the receptor couples to Gq/G11 pathways leading to calcium mobilization . Complementary approaches measuring phosphoinositide signaling (IP₃ or DAG production) can further characterize the activation of the phosphatidylinositol-calcium second messenger system .

For the most physiologically relevant assessment, in vivo scratching behavior serves as a functional readout of Mrgpra1 activation in the context of itch sensation . Studies comparing wild-type and Mrgpra1-knockout mice have successfully used this approach to demonstrate the receptor's role in both direct bilirubin-induced itch and cholestatic disease models .

How can Mrgpra1 be targeted for potential therapeutic development?

Given the role of Mrgpra1 in cholestatic itch, the receptor represents a promising target for developing anti-pruritic therapeutics . Pharmacological antagonists of Mrgpra1, such as the tripeptide glutaminyl-D-tryptophylphenylalanine (QWF), have shown promise in reducing itch in mouse models and could serve as chemical templates for drug development . The tripeptide's effectiveness suggests that small-molecule or peptide-based approaches may be viable strategies for targeting this receptor.

Understanding the structure-function relationship of Mrgpra1 and its ligands could facilitate the development of more specific and potent antagonists. While direct structural data for mouse Mrgpra1 is limited, the shallow orthosteric pocket and conformational plasticity observed in related receptors like MRGPRX1 provide valuable insights for rational drug design . The unique TM3-TM4 pocket feature that accommodates specific peptide motifs could be exploited for selective targeting .

For translational research, it's important to consider that human MRGPRX4 serves a similar function to mouse Mrgpra1 in cholestatic pruritus . Therefore, parallel development of MRGPRX4 antagonists might be necessary for clinical applications. Combination approaches targeting multiple components of the itch signaling pathway could also prove effective, particularly in complex pruritic conditions like cholestasis where multiple mediators may be involved.

What genetic tools are available for studying Mrgpra1 function?

Several genetic approaches have been successfully employed to study Mrgpra1 function, with Mrgpra1-knockout mice being the most widely used tool . These knockout models have demonstrated significantly reduced scratching in response to both direct bilirubin injection and in disease models of cholestasis (induced by ANIT and cyclosporin) . The availability of these knockout lines provides a valuable resource for investigating the receptor's role in various itch conditions.

Beyond conventional knockouts, conditional genetic approaches using Cre-lox systems could enable tissue-specific or temporally controlled deletion of Mrgpra1, allowing for more nuanced investigation of its function in specific contexts. CRISPR/Cas9 technology offers opportunities for generating precise mutations to study structure-function relationships, such as targeted modifications of the ligand-binding pocket or G-protein coupling domains.

Reporter lines expressing fluorescent proteins under the Mrgpra1 promoter would facilitate visualization of Mrgpra1-expressing neurons in vivo and ex vivo, enabling targeted electrophysiological recordings and calcium imaging studies. Chemogenetic approaches, such as expressing Designer Receptors Exclusively Activated by Designer Drugs (DREADDs) in Mrgpra1-positive neurons, could allow for selective activation or inhibition of these neurons to further dissect their contribution to itch circuits.

What are the major limitations in current Mrgpra1 research?

A significant challenge in Mrgpra1 research is the lack of direct human orthologs, complicating translation of findings to clinical applications . While functional similarities exist between mouse Mrgpra1 and human MRGPRX receptors, particularly MRGPRX4 in the context of cholestatic itch, the evolutionary divergence necessitates careful interpretation of mouse studies when considering human applications .

The shallow orthosteric pocket and conformational plasticity of these receptors (inferred from studies of related receptors) present challenges for developing highly specific ligands . Additionally, the related nature of various Mrgpr family members raises concerns about cross-reactivity, requiring rigorous specificity testing of experimental tools .

Methodological limitations include the historical reliance on less sensitive detection methods like in situ hybridization, which may have underestimated Mrgpra1 expression in certain contexts . The development of more specific antibodies, improved genetic tools, and higher-resolution structural data would significantly advance the field. Furthermore, a more comprehensive understanding of the full spectrum of Mrgpra1 ligands and their relative potencies would provide valuable insights into the receptor's physiological roles.

What are emerging research directions for Mrgpra1?

Recent advances in structural biology of related receptors, particularly human MRGPRX1, open new avenues for structure-based drug design targeting Mrgpra1 . The identification of key structural features, such as the unique pocket at the extracellular ends of TM3 and TM4 that accommodates specific peptide motifs, provides valuable templates for rational design of selective ligands .

The discovery of bilirubin as an endogenous Mrgpra1 activator raises questions about other potential physiological ligands and their roles in various pathological conditions beyond cholestasis . Investigation of Mrgpra1 in models of inflammatory, neuropathic, and other forms of pathological itch could reveal broader implications for pruritus treatment.

Exploring the intersection of pain and itch signaling through Mrgpra1 represents another promising research direction. Given that activation of related receptors like MRGPRX1 in central terminals of primary sensory neurons can lead to Gi1 pathway activation and attenuation of chronic pain, Mrgpra1 might similarly play dual roles in sensory processing . This complexity suggests potential for targeted modulation of specific signaling pathways downstream of Mrgpra1 to achieve desired therapeutic outcomes in either pain or itch conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.