Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2)

Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2) is a member of the Mas-related G-protein coupled receptor (Mrgpr) family, which plays a crucial role in the regulation of innate immunity. Specifically, Mrgpra2 is expressed in neutrophils and acts as a receptor for keratinocyte-derived defensins, contributing to effective neutrophil-mediated skin immunity and microbiome homeostasis .

Structure and Function

Mrgpra2 is encoded by two genes, Mrgpra2a and Mrgpra2b, which are located next to each other within the Mrgpr gene cluster. These genes differ by only two amino acids and likely arose through gene duplication . The receptors encoded by these genes are activated by specific beta-defensins, such as human beta-defensin 3 (hBD3) and its mouse homologue mouse beta-defensin 14 (mBD14), which are crucial for neutrophil activation and immune response .

Expression and Localization

Mrgpra2 is specifically expressed in neutrophils, a type of granulocyte involved in the innate immune response. It is not found in other granulocytes like mast cells, basophils, or eosinophils, nor in monocytes, macrophages, or dendritic cells . This specificity highlights its unique role in neutrophil function and skin immunity.

Role in Immune Response

The activation of Mrgpra2 by defensins is essential for neutrophil-mediated immune responses. Studies using mutant mouse lines lacking Mrgpra2 have shown impaired neutrophil activation in response to defensins, underscoring the importance of this receptor in maintaining effective skin immunity and microbiome balance .

Research Findings

AspectDescriptionSource
ExpressionExpressed specifically in neutrophils.
LigandsActivated by keratinocyte-derived defensins like hBD3 and mBD14.
FunctionEssential for neutrophil activation and skin immunity.
LocalizationFound in bone marrow and peripheral blood neutrophils.

References

- Keratinocyte-derived defensins activate neutrophil-specific receptors Mrgpra2a/b on neutrophils, contributing to effective neutrophil-mediated skin immunity and microbiome homeostasis.
- Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2) product information.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this in your order notes, and we will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mrgpra2; Mrga2; Mas-related G-protein coupled receptor member A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mrgpra2
Target Protein Sequence
MDETLPGSINIRILIPKLMIIIFGLVGLMGNAIVFWLLGFHLRRNAFSVYILNLALADFL FLLSSIIASTLFLLKVSYLSIIFHLCFNTIMMVVYITGISMLSAISTECCLSVLCPTWYR CHRPVHTSTVMCAVIWVLSLLICILNSYFCAVLHTRYDNDNECLATNIFTASYMIFLLVV LCLSSLALLARLFCGAGQMKLTRFHVTILLTLLVFLLCGLPFVIYCILLFKIKDDFHVLD VNFYLALEVLTAINSCANPIIYFFVGSFRHQLKHQTLKMVLQSALQDTPETAENMVEMSS NKAEP
Uniprot No.

Target Background

Function
This receptor belongs to the orphan receptor family. It may act as a receptor for RFamide-family neuropeptides, such as NPFF and NPAF, which are known to have analgesic effects in vivo. It is believed to play a role in regulating nociceptor function and development, potentially contributing to the sensation or modulation of pain.
Gene References Into Functions
  1. Research indicates that members of the Mrgpr family, particularly MrgprC11, may serve as an endogenous inhibitory mechanism for regulating persistent pain in mice. PMID: 20724664
  2. Deletion of the Mas protooncogene eliminates the binding of Ang-(1-7) to mouse kidneys. This supports the notion that Mas is a functional receptor for Ang-(1-7). PMID: 12829792
  3. Mas deficiency in FVB/N mice leads to significant changes in glucose and lipid metabolism, resulting in a metabolic syndrome-like state. PMID: 18025412
Database Links

KEGG: mmu:235712

UniGene: Mm.425459

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons that includes nociceptors. Expressed in the subclass of non-peptidergic sensory neurons that are IB4(+) and VR1(-).

Q&A

How does Mrgpra2 relate to other members of the MRGPR family?

Mrgpra2 belongs to the Mas-related G-protein coupled receptor family, which includes multiple subtypes in mice (Mrgpra, Mrgprb, Mrgprc, etc.). While the provided search results focus primarily on MRGPRX2 (human) and Mrgprb2 (mouse), it's important to recognize that Mrgpra2 represents a distinct subtype within this receptor family. The mouse genome contains multiple Mrgpr genes organized in clusters, with the Mrgpra subfamily containing multiple members (Mrgpra1-10) that likely arose through gene duplication events. Research comparing different MRGPR subtypes requires careful attention to their evolutionary relationships.

What experimental approaches should be used when studying Mrgpra2 versus other MRGPR family members?

When investigating Mrgpra2, researchers should be cautious about extrapolating findings from other family members like Mrgprb2. While the search results indicate that MRGPRX2 and Mrgprb2 are activated by similar compounds including basic secretagogues and neurokinins , Mrgpra2 may have distinct pharmacological profiles. To address this:

  • Use receptor-specific antibodies validated for Mrgpra2

  • Employ sequence-verified expression constructs

  • Include appropriate controls with related receptors

  • Validate findings using knockout models specific to Mrgpra2

  • Consider potential cross-reactivity with other Mrgpra subfamily members

What are the challenges in studying Mrgpra2 receptor compared to human MRGPRX2?

Studying mouse Mrgpra2 presents several challenges compared to human MRGPRX2. The human MRGPRX family has fewer members than mouse Mrgprs, and direct orthology relationships aren't always clear. While MRGPRX2 has been extensively characterized and shown to respond to prodynorphin-derived peptides , the specific ligand profile of Mrgpra2 may differ. Additionally, the search results mention that antagonists studied for MRGPRX2 were human-specific , suggesting species differences in pharmacological responses that necessitate careful experimental design when translating findings between species.

How is Mrgpra2 expression regulated in different tissues and cell types?

While the search results don't directly address Mrgpra2 expression patterns, MRGPR family members generally show tissue-specific expression profiles. Based on studies of related receptors, researchers investigating Mrgpra2 expression should:

  • Use RT-PCR with sequence-specific primers (similar to those used in the RT² Profiler PCR Array for GPCRs )

  • Perform immunohistochemistry with validated antibodies

  • Utilize reporter mice or in situ hybridization for tissue localization

  • Examine expression in both naive conditions and disease models

  • Compare expression patterns with other Mrgpra subfamily members

Research suggests MRGPR family members are often expressed in sensory neurons and certain immune cells, but Mrgpra2's specific expression pattern requires targeted investigation.

What role does Mrgpra2 play in mast cell activation compared to Mrgprb2?

  • Compare expression levels of Mrgpra2 versus Mrgprb2 in various mast cell populations

  • Test whether Mrgpra2-specific ligands induce degranulation

  • Evaluate calcium mobilization in mast cells expressing Mrgpra2

  • Use genetic approaches (siRNA, CRISPR) to specifically manipulate Mrgpra2

  • Consider potential functional redundancy between MRGPR family members

The calcium mobilization assay described for MRGPRX2 screening represents a methodological approach that could be adapted for Mrgpra2 studies.

What are optimal methods for generating functional recombinant Mrgpra2?

Based on approaches used for related receptors, researchers working with recombinant Mrgpra2 should consider:

  • Expression vector selection: Vectors with strong promoters (CMV, EF1α) for mammalian expression

  • Host cell options:

    • HEK293 cells (as used for MRGPRX2/Gα15 cells in high-throughput screening )

    • CHO cells for stable expression

    • Sf9 insect cells for structural studies

  • Addition of epitope tags (His, FLAG) for purification while confirming they don't interfere with function

  • Codon optimization for the expression system

  • Co-expression with appropriate G proteins to enhance coupling efficiency

Functional validation using calcium mobilization assays similar to those described for MRGPRX2 would confirm proper receptor expression and activity.

What assays are most reliable for measuring Mrgpra2 activation in vitro?

Drawing from methodologies used for related receptors, researchers should consider these approaches for Mrgpra2:

  • Calcium mobilization assays: The FLIPR TETRA system used for MRGPRX2 allows high-throughput detection of receptor activation

  • β-arrestin recruitment assays: The PRESTO-Tango assay mentioned for MRGPRX2 provides an alternative readout

  • GTPγS binding assays: For direct measurement of G protein activation

  • Electrophysiology: For studying channel regulation in neurons

  • Mast cell degranulation assays: Measuring β-hexosaminidase release

Each assay has advantages for different research questions. For example, calcium assays provide rapid kinetic data, while β-arrestin assays may detect biased signaling.

How can researchers develop selective tools to study Mrgpra2 function?

Development of Mrgpra2-selective tools requires strategies such as:

  • In silico approaches: The structure-based computational methods described for MRGPRX2 could be adapted for Mrgpra2:

    • Homology modeling based on related GPCRs

    • Virtual screening of compound libraries

    • Molecular dynamics simulations to understand binding pocket dynamics

  • Experimental validation:

    • Test candidate compounds in cells expressing only Mrgpra2

    • Confirm specificity against related receptors (Mrgpra1, Mrgpra3, Mrgprb2)

    • Evaluate both agonist and antagonist activities

  • Generation of genetic tools:

    • Receptor-specific knockouts or knock-ins

    • Similar to the MRGPRX2 knock-in mice mentioned , which were useful for studying itch behaviors

How do endogenous opioid peptides interact with Mrgpra2 compared to Mrgprb2 and MRGPRX2?

The search results indicate that MRGPRX2 is activated by prodynorphin-derived peptides , but Mrgpra2's response to these peptides isn't directly addressed. Researchers investigating this question should:

  • Test dynorphin peptides (dynorphin A 1-17, dynorphin B, α-neoendorphin) with recombinant Mrgpra2

  • Compare EC50 values between Mrgpra2, Mrgprb2, and MRGPRX2

  • Investigate structure-activity relationships:

    • For MRGPRX2, both the N-terminal YGGF motif and C-terminal cationic tail were important for activation

    • Determine if these structural requirements are conserved for Mrgpra2

  • Evaluate potential G protein bias in signaling similar to that observed with dynorphin peptides at MRGPRX2

What experimental approaches best identify cross-reactivity between Mrgpra2 and drug compounds?

Several drugs have been shown to activate MRGPRX2, including neuromuscular blocking agents, fluoroquinolones, and vancomycin . To investigate potential Mrgpra2 activation by drugs:

  • Screen drug libraries using cell-based assays expressing recombinant Mrgpra2

  • Compare responses to those of cells expressing Mrgprb2 or MRGPRX2

  • Validate hits using multiple assay types (calcium flux, β-arrestin recruitment)

  • Confirm specificity using competitive antagonists or receptor knockouts

  • For promising compounds, perform structure-activity relationship studies

This approach would help determine whether Mrgpra2 contributes to drug hypersensitivity reactions similar to MRGPRX2.

How can researchers develop Mrgpra2 knockout or transgenic mouse models?

Based on approaches used for related receptors, researchers could generate Mrgpra2-specific genetic models through:

  • CRISPR/Cas9 gene editing targeting Mrgpra2-specific sequences

  • Traditional homologous recombination approaches

  • Generation of reporter mice (e.g., Mrgpra2-GFP) to track expression

  • Creation of conditional knockout models using Cre-loxP systems

  • Development of humanized models similar to the MRGPRX2 knock-in mice described

For the MRGPRX2 knock-in mice, researchers evaluated itch behaviors following compound 48/80 injection, with antagonist pre-treatment significantly reducing scratching behaviors . Similar behavioral paradigms could be applied to Mrgpra2 models.

What is the potential role of Mrgpra2 in drug hypersensitivity reactions?

While MRGPRX2 and Mrgprb2 have established roles in drug-induced mast cell degranulation and hypersensitivity reactions , the specific contribution of Mrgpra2 remains to be determined. Researchers investigating this question should:

  • Compare expression of Mrgpra2 and Mrgprb2 in mouse mast cells

  • Determine whether drugs that activate MRGPRX2/Mrgprb2 also activate Mrgpra2

  • Use selective genetic approaches to distinguish Mrgpra2-mediated from Mrgprb2-mediated responses

  • Investigate whether polymorphisms in Mrgpra2 affect drug sensitivity

  • Study potential interactions between Mrgpra2 and IgE-dependent pathways

The finding that polymorphisms in MRGPRX2 may predispose individuals to drug reactions suggests similar mechanisms could be relevant for Mrgpra2.

How can researchers distinguish between MRGPR-mediated and IgE-dependent mast cell activation?

Distinguishing these pathways is critical for understanding drug hypersensitivity. Based on current research , approaches include:

  • Comparative analysis of activation kinetics (MRGPR-mediated responses tend to be more rapid)

  • Differential sensitivity to inhibitors:

    • IgE-dependent responses are blocked by anti-IgE antibodies

    • MRGPR-specific antagonists should block only that pathway

  • Analysis of downstream signaling differences

  • Studies in genetically modified mice lacking specific pathway components

  • Single-cell analysis to identify distinct activation signatures

Understanding these differences has important clinical implications for interpreting drug-provoked hypersensitivity reactions and skin tests .

What structural features determine ligand specificity across different MRGPR family members?

Understanding the structural basis of ligand recognition would advance MRGPR research. Approaches should include:

  • Comparative homology modeling:

    • Use the κ-opioid receptor as a template (as done for MRGPRX2 )

    • Generate multiple models to sample conformational space

    • Validate models against experimental binding data

  • Mutational analysis of key residues:

    • Identify conserved and divergent residues across MRGPR subtypes

    • Create point mutations to test their impact on ligand binding

    • Focus on regions identified in MRGPRX2 as important for opioid peptide binding

  • Structure-activity relationship studies with diverse ligands

Such approaches could help develop subtype-selective compounds for both research and potential therapeutic applications.

How can single-cell technologies advance our understanding of Mrgpra2 biology?

Single-cell approaches offer powerful tools for studying receptor expression and function:

  • Single-cell RNA sequencing to identify specific cell populations expressing Mrgpra2

  • Single-cell proteomics to confirm protein expression levels

  • High-content imaging to track receptor localization and trafficking

  • CRISPR screens to identify genes that regulate Mrgpra2 function

  • Single-cell calcium imaging to measure functional responses

These approaches could reveal heterogeneity in Mrgpra2 expression and function across different cell populations that might be missed by bulk analysis methods.

What are the most promising applications of computational methods in Mrgpra2 research?

Based on computational approaches used for MRGPRX2 , researchers could:

  • Apply structure-based virtual screening:

    • Generate homology models of Mrgpra2

    • Screen virtual compound libraries (similar to the ZINC database mentioned )

    • Identify novel chemotypes with potential activity

  • Use molecular dynamics simulations to:

    • Study receptor conformational dynamics

    • Predict ligand binding modes

    • Understand activation mechanisms

  • Implement machine learning approaches to:

    • Predict new ligands based on known actives

    • Identify structural features important for selectivity

    • Accelerate drug discovery efforts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.