Recombinant Mouse Mas-related G-protein coupled receptor member A5 (Mrgpra5)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant Mrgpra5 is produced using multiple expression systems, each yielding distinct post-translational modifications:

Product IDHost SystemTagPuritySource
MRGPRA5-10022MMammalian CellsHis≥85%
MRGPRA5-5668MHEK293Avi/Fc/His≥85%
RFL35170MFE. coliHis≥85%
  • Mammalian Systems (e.g., HEK293): Preserve native glycosylation and ligand-binding properties .

  • Bacterial Systems (e.g., E. coli): Cost-effective for large-scale production but lack post-translational modifications .

Functional and Pathway Analysis

Mrgpra5 participates in sensory and immune pathways:

  • Nociception: Expressed in dorsal root ganglia neurons, where it modulates pain and itch responses .

  • Immune Regulation: Indirectly influences mast cell degranulation via cross-talk with MRGPRX2 .

Key Signaling Pathways:

PathwayAssociated ProteinsRole of Mrgpra5
Gi-coupled signalingGαi, cAMP, MAPKInhibits adenylyl cyclase, reducing cAMP levels .
Calcium mobilizationPLC-β, IP3Triggers intracellular calcium release via Gβγ subunits .

Research Findings and Implications

  • Ligand Specificity: Mrgpra5 recognizes small peptides and amines, though its endogenous ligand remains unidentified .

  • Constitutive Activity: Structural studies of related MRGPRs (e.g., MrgD) suggest ligand-independent basal activity via TM3-TM6 hydrophobic interactions .

  • Therapeutic Potential: Targeting Mrgpra5 could alleviate chronic pain or inflammatory conditions, but species-specific sequence divergence complicates translational research .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us. We will prioritize developing the specified tag.
Synonyms
Mrgpra5; Mrga5; Mas-related G-protein coupled receptor member A5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mrgpra5
Target Protein Sequence
MDKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYILNLALADFVF LLCHIIDSMLLLLTVFYPNNIFSGYFYTIMTVPYIAGLSMLSAISTELCLSVLCPIWYRC HHPEHTSTVMCAAIWVLPLLVCILNRYFCSFLDINYNNDKQCLASNFFTRAYLMFLFVVL CLSSMALLARLFCGTGQMKLTRLYVTIMLTVLGFLLCGLPFVIYYFLLFNIKDGFCLFDF RFYMSTHVLTAINNCANPIIYFFEGSFRHQLKHQTLKMVLQSVLQDTPEIAENMVEMSRN IPKP
Uniprot No.

Target Background

Function
Orphan receptor. May act as a receptor for RFamide-family neuropeptides such as NPFF and NPAF, which exhibit analgesic effects in vivo. It may regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links

KEGG: mmu:404235

UniGene: Mm.484774

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons that includes nociceptors. Expressed in the subclass of non-peptidergic sensory neurons that are IB4(+) and VR1(-).

Q&A

What biological functions does Mrgpra5 perform?

Mrgpra5 exhibits several key biochemical functions:

FunctionRelated Proteins
G-protein coupled receptor activityADCYAP1R1A, HTR1E, FZD2, DRD4-RS, FFAR3, RRH, LPAR4, S1PR1, S1PR2, TAAR14J
Signal transducer activityGPR25, MAGI2, ADRA2DA, F2RL2, PTGER2B, TAAR15, GPR132, TAAR12E, TAS2R103, ADRB3A
Molecular functionVPS13A, MUP17, TMEM91, SPP2, LYRM5B, TEKT3, PHB2B, GM10591, ASXL3, TMEM246

As a GPCR, Mrgpra5 primarily functions in signal transduction pathways, where it mediates the conversion of extracellular stimuli into intracellular responses.

How can I incorporate Mrgpra5 into a Massively Parallel Reporter Assay (MPRA)?

To incorporate Mrgpra5 regulatory elements into an MPRA experiment:

  • Design synthesis: Identify potential regulatory sequences around the Mrgpra5 gene using genomic databases and chromatin accessibility data.

  • Library construction: Synthesize identified sequences with 15 bp adapters on either side. Then amplify the library and add a minimal promoter and 15 bp random barcode downstream of each synthesized sequence .

  • Vector construction: Clone the sequences into a lentiMPRA vector upstream of a reporter gene (e.g., GFP) .

  • Cellular delivery: Transfect or transduce cells of interest with the MPRA library.

  • Activity measurement: Measure enhancer activity as the ratio of transcribed barcode reads (via RNA-seq) to integrated genomic barcode reads (via DNA-seq) .

  • Statistical analysis: Apply a Gaussian mixture model to evaluate the contribution of background noise in the measured activity signal and identify truly active regulatory elements .

This approach is particularly valuable for studying gene regulation during neurodevelopment or other biological processes. In recent studies, MPRA experiments have identified approximately 35% of tested enhancers as actively functioning in cellular models .

What statistical approaches are recommended for analyzing allele-specific activity in MPRA experiments involving Mrgpra5?

When analyzing allele-specific activity in MPRA experiments involving Mrgpra5 variants, several statistical approaches are available, each with distinct advantages:

Statistical MethodStrengthsLimitationsApplication
QuASAR-MPRAAccounts for overdispersion and base-calling errors; Produces well-calibrated p-valuesRequires parameter estimationIdeal for precise allele-specific analysis
Student's t-testSimple implementation using log2 ratiosMay produce inflated p-valuesSuitable for initial screening
Fisher's exact testWorks directly with count dataOften requires pseudocount additionGood for low-count scenarios
Beta-binomial modelsAccounts for overdispersionRequires larger sample sizesBest for extensive datasets

The QuASAR-MPRA statistical test is particularly recommended as it better calibrates p-values under the null hypothesis without sacrificing statistical power. This approach extends the QuASAR method to test for allelic imbalance when default proportions are not equal .

For validation, researchers should calculate the genomic inflation parameter (λ) to quantify p-value distribution inflation and assess false positive rates. Simulations using beta-binomial distributions approximating real data can help evaluate statistical power and false discovery rates under specific assumptions .

How should I design experiments to study Mrgpra5 in mouse models with limited sample sizes?

When designing experiments to study Mrgpra5 in mouse models with limited sample sizes, consider implementing a Blind Start study design:

  • Randomization: Randomize subjects to multiple groups (e.g., 4 blinded groups), with each group crossing over to active treatment at different timepoints .

  • Efficacy analysis: Compare the last assessment before crossover to measurements after a defined treatment period (e.g., 24 weeks) .

  • Multi-Domain Responder Index (MDRI): Develop an MDRI using prespecified minimal important differences across multiple functional domains relevant to Mrgpra5 activity .

  • Biomarker validation: Include appropriate biomarkers as secondary endpoints to strengthen evidence of biological activity.

This approach improves statistical power by reducing the impact of heterogeneity in small sample sizes. The MDRI design enhances detection of positive treatment effects by considering multiple domains rather than relying on a single primary endpoint .

What sampling approaches can optimize data collection when working with large datasets involving Mrgpra5?

When working with large datasets (Big Data) involving Mrgpra5, several sampling approaches can optimize data collection and analysis:

  • Retrospective designed sampling: Rather than analyzing the entire dataset, extract a subset through a principled design approach to answer specific questions .

  • Sequential optimal design: Implement Algorithm 1 from Principles of Experimental Design for Big Data Analysis:

    • Select initial training samples randomly

    • Calculate the observed information matrix

    • Use a utility function to determine optimal design points

    • Select observations from the remaining data based on Euclidean distance to optimal designs

    • Update parameter estimates and repeat

This approach significantly improves parameter estimation precision compared to random sampling. In simulation studies, researchers found that randomly selected data subsets had to be roughly doubled in size to achieve comparable utility to the designed approach .

For Bayesian analysis, consider:

  • Extract a random selection (e.g., n=5,000) for an initial learning phase

  • Develop prior distributions based on maximum likelihood estimates

  • Implement sequential Monte Carlo (SMC) algorithms to approximate target distributions

  • Use utility functions to select designs that yield precise parameter estimates

How does choice complexity affect experimental design when studying Mrgpra5 and related G-protein coupled receptors?

When designing experiments involving multiple variants or conditions of Mrgpra5 and related GPCRs, researchers should consider the psychological phenomenon where excessive choice complexity can be demotivating:

Studies have shown that people are more likely to make selections and report greater satisfaction when presented with limited options (6 choices) versus extensive options (24-30 choices) . For example, in one study, participants spent significantly more time deciding when presented with 30 options (M = 24.36 seconds, SD = 12.99) compared to 6 options (M = 8.91, SD = 6.02) .

Applied to Mrgpra5 research, this suggests:

  • Experimental design: When designing assays requiring researcher decisions (e.g., selection of constructs or conditions), limit options to prevent decision paralysis.

  • Sequential testing approach: Rather than testing all variants simultaneously, organize testing in manageable batches of 5-7 variants.

  • Choice architecture: When multiple protocol options exist, structure decision points to avoid overwhelming collaborators with too many simultaneous choices.

This approach can improve research efficiency and potentially lead to greater satisfaction with experimental outcomes .

What are the recommended methods for handling data contradictions in Mrgpra5 functional studies?

When encountering contradictory results in Mrgpra5 functional studies, implement a systematic approach:

  • Statistical reanalysis: Apply multiple statistical methods to verify findings. For example, if using Student's t-test, confirm with a beta-binomial model that accounts for overdispersion .

  • Cross-validation with diverse experimental methods: Verify findings using orthogonal approaches. For instance, complement MPRA results with chromatin accessibility data or traditional reporter assays .

  • Correlation with gene expression: Analyze whether the activity of putative Mrgpra5 regulatory elements correlates with gene expression. Research shows that genes linked to MPRA-active enhancers exhibit significantly higher expression levels than those associated with inactive enhancers .

  • Evaluation of experimental limitations: Consider factors such as temporal specificity, as many enhancers show temporal-specific activity during development, suggesting evolving roles .

  • Negative correlation examination: Investigate cases where negative correlations appear, as these often require deeper analysis. In some experimental designs, negative correlations can indicate important underlying biological phenomena rather than experimental artifacts .

By systematically addressing contradictions through multiple analytical approaches, researchers can resolve inconsistencies and build stronger evidence for Mrgpra5 function.

What ethical considerations should be prioritized when conducting Mrgpra5 research involving animal models?

When conducting Mrgpra5 research with animal models, several ethical principles must be prioritized:

  • Compliance with the Belmont Report principles: Ensure respect for subjects, beneficence, and justice in experimental design11.

  • Informed consent for tissue acquisition: Obtain proper authorization for acquiring animal tissues for experimental purposes.

  • Application of the 3Rs principle:

    • Replacement: Consider in vitro alternatives where possible

    • Reduction: Design statistically powerful experiments to minimize animal numbers

    • Refinement: Implement methods that minimize suffering

  • Ethical treatment of control groups: Avoid unnecessarily harmful or permanently affecting control conditions. Historical unethical practices, such as those in the Little Albert experiment, where subjects were conditioned to fear and never reconditioned, must be avoided11.

  • Transparency in reporting: Clearly document all procedures, including unexpected outcomes or adverse events, to contribute to the ethical development of the field.

  • Statistical rigor: Implement appropriate statistical analysis to ensure scientific validity and prevent unnecessary animal use. Consider adopting methods such as the Blind Start study design to improve statistical power while minimizing subject numbers .

What are the best practices for reporting MPRA results in studies of Mrgpra5 regulatory elements?

When reporting MPRA results for Mrgpra5 regulatory elements, follow these best practices:

  • Comprehensive methodology documentation:

    • Detail library design and construction methods

    • Specify cell types and differentiation protocols used

    • Document sequencing depth and quality control metrics

    • Report barcode association statistics (e.g., average of 39.9 unique barcodes per enhancer sequence)

  • Statistical analysis reporting:

    • Clearly describe the statistical model used to identify active enhancers (e.g., Gaussian mixture model)

    • Report both raw activity values and normalized results

    • Include appropriate statistical tests with multiple testing correction

  • Data visualization:

    • Present activity distributions of test sequences versus controls

    • Include correlations between replicates

    • Show relationships between enhancer activity and gene expression

  • Integration with genomic context:

    • Report how enhancers were linked to target genes (proximity in linear DNA or 3D conformation data)

    • Compare expression levels of genes linked to active versus inactive enhancers

  • Negative findings inclusion: Report the percentage of sequences that did not show activity (~65% of tested enhancers typically show no activity) .

  • Data availability: Deposit raw sequencing data in public repositories and share processed data and analysis code to enable reproducibility.

Following these reporting guidelines ensures research transparency and facilitates integration of findings into the broader scientific understanding of Mrgpra5 regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.