Recombinant Mouse Mas-related G-protein coupled receptor member A7 (Mrgpra7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development to meet your specifications.
Synonyms
Mrgpra7; Mrga7; Mas-related G-protein coupled receptor member A7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mrgpra7
Target Protein Sequence
MDETSPRSIDIESLIPNLMIIIFGLVGLTGNAIVLWLLGFCLHRNAFLVYILNLALADFL FLLCHFINSAMFLLKVPIPNGIFVYCFYTIKMVLYITGLSMLSAISTERCLSVLCPIWYH CRRPEHTSTVMCAVIWIFSVLICILKEYFCDFFGTKLGNYYVCQASNFFMGAYLMFLFVV LCLSTLALLARLFCGAEKMKFTRLFVTIMLTILVFLLCGLPWGFFWFLLIWIKGGFSVLD YRLYLASIVLTVVNSCANPIIYFFVGSFRHRLKHQTLKMVLQSALQDTPETHENMVEMSR IKAEQ
Uniprot No.

Target Background

Function

Orphan receptor potentially interacting with RFamide-family neuropeptides (e.g., NPFF and NPAF), which exhibit analgesic effects in vivo. It may play a regulatory role in nociceptor function and/or development, influencing pain sensation and modulation.

Database Links

KEGG: mmu:404236

UniGene: Mm.297430

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons that includes nociceptors. Expressed in the subclass of non-peptidergic sensory neurons that are IB4(+) and VR1(-).

Q&A

What is Mrgpra7 and what is its significance in immunological research?

Mrgpra7 is a member of the Mas-related G protein-coupled receptor (Mrgpr) subfamily, originally described in nociceptive neurons of the dorsal root ganglia. Like other members of this family, Mrgpra7 likely plays roles in both neuronal and immune functions. Understanding this receptor is significant for research into neuroimmune interactions, as related Mrgpr receptors have been implicated in mast cell activation, neurogenic inflammation, and pain sensation .

To study this receptor effectively, researchers should consider its expression patterns in both neural tissues and immune cells. Methodologically, this requires tissue-specific isolation techniques and cell sorting protocols to identify Mrgpra7-expressing cells before functional studies can begin.

How does Mrgpra7 differ from other mouse Mrgpr family members?

Mrgpra7 is one of several members of the mouse Mrgpr family, which includes other subtypes such as Mrgprb2. While all belong to the same G protein-coupled receptor family, they exhibit distinct tissue expression patterns, ligand specificity, and downstream signaling pathways .

To distinguish Mrgpra7 from other family members in your research:

  • Use receptor-specific antibodies for immunohistochemistry and flow cytometry

  • Design PCR primers that target unique regions of the Mrgpra7 gene

  • Employ selective ligands or inhibitors when available

  • Consider knockout models to confirm specificity of observed effects

What are the standard methods for detecting Mrgpra7 expression in tissue samples?

To detect Mrgpra7 expression in tissue samples, several complementary approaches are recommended:

MethodApplicationAdvantagesLimitations
RT-PCRGene expressionHigh sensitivity, quantitativeCannot localize to specific cells
In situ hybridizationmRNA localizationCellular resolutionTechnical complexity
ImmunohistochemistryProtein localizationVisual cellular contextAntibody specificity concerns
Western blotProtein expressionSemi-quantitativeLacks spatial resolution
Flow cytometryCellular expressionSingle-cell analysisRequires tissue dissociation

For optimal results, validate expression using at least two independent methods, and always include appropriate positive and negative controls to ensure specificity.

How should I design experiments to study Mrgpra7 function in vitro?

When designing experiments to study Mrgpra7 function in vitro, follow these methodological steps:

  • Begin with a clear, focused research question about Mrgpra7 function

  • Select appropriate cell models that naturally express or can be transfected with Mrgpra7

  • Design treatments that target Mrgpra7 activation or inhibition

  • Include proper controls:

    • Vehicle controls

    • Cells lacking Mrgpra7 expression

    • Treatments with non-specific ligands

  • Plan for multiple independent replicates (minimum n=3)

  • Determine appropriate outcome measures based on expected signaling pathways

  • Consider temporal dynamics in your experimental design

For example, if studying calcium signaling downstream of Mrgpra7, design a time-course experiment with appropriate calcium indicators and stimuli, while controlling for non-specific effects using receptor antagonists or cells lacking Mrgpra7 expression.

What are the key considerations for developing a recombinant Mrgpra7 expression system?

To develop an effective recombinant Mrgpra7 expression system:

  • Vector selection: Choose an expression vector with appropriate promoters for your target cell type

  • Codon optimization: Optimize the Mrgpra7 coding sequence for the host expression system

  • Epitope tagging: Consider adding epitope tags (His, FLAG, HA) for detection and purification, placed to minimize interference with receptor function

  • Signal peptide: Ensure proper membrane trafficking by including appropriate signal sequences

  • Expression validation: Use multiple methods to confirm expression:

    • Western blotting

    • Immunofluorescence for membrane localization

    • Functional assays to confirm receptor activity

  • Stable vs. transient expression: Determine whether your experimental design requires stable cell lines or if transient expression is sufficient

  • Expression level control: Consider using inducible expression systems to control expression levels

Each of these factors can significantly impact experimental outcomes and should be carefully optimized for your specific research questions.

How can I ensure reproducibility in Mrgpra7 functional assays?

Ensuring reproducibility in Mrgpra7 functional assays requires systematic attention to multiple experimental variables:

  • Standardize cell culture conditions:

    • Passage number (use cells within a defined passage range)

    • Cell density and confluence at time of experiment

    • Growth media composition and serum batch

    • Time between plating and assay

  • Establish consistent assay protocols:

    • Fixed timelines for reagent addition

    • Standardized volumes and mixing procedures

    • Consistent incubation times and temperatures

    • Calibrated equipment settings

  • Include internal controls:

    • Known Mrgpr agonists as positive controls

    • Vehicle-only treatments as negative controls

    • Reference compounds with established dose-response relationships

  • Implement rigorous data handling practices:

    • Pre-determined analysis pipelines

    • Blinded analysis where possible

    • Consistent normalization procedures

    • Statistical power calculations to determine appropriate sample sizes

  • Document all experimental conditions comprehensively in laboratory notebooks and methods sections

What approaches are most effective for studying Mrgpra7 signaling pathways?

Studying Mrgpra7 signaling pathways requires a comprehensive suite of complementary techniques:

  • G-protein coupling analysis:

    • GTPγS binding assays to measure G-protein activation

    • BRET/FRET-based sensors to monitor receptor-G protein interactions

    • Selective G-protein inhibitors to define coupling preferences

  • Second messenger analysis:

    • Real-time calcium imaging

    • cAMP accumulation assays

    • IP3 and DAG measurements

    • ERK phosphorylation assays

  • β-arrestin recruitment:

    • BRET/FRET-based arrestin recruitment assays

    • Confocal microscopy for arrestin translocation

    • Functional assays in arrestin knockout cells

  • Receptor trafficking studies:

    • Surface biotinylation assays

    • Internalization assays using pH-sensitive fluorophores

    • Recycling studies with antibody feeding techniques

  • Pathway validation approaches:

    • Pharmacological inhibitors of specific pathway components

    • siRNA or CRISPR-based knockdown/knockout of pathway elements

    • Reconstitution studies in heterologous expression systems

To effectively map Mrgpra7 signaling, employ multiple techniques and validate findings across different cell types and experimental conditions.

How can I identify and validate novel ligands for Mrgpra7?

Identifying and validating novel ligands for Mrgpra7 requires a systematic approach:

  • Initial screening strategies:

    • Computational modeling based on known ligands of related receptors

    • High-throughput calcium mobilization or other functional assays

    • Peptide library screening, particularly focusing on endogenous neuropeptides and host defense peptides

    • Fragment-based drug discovery approaches

  • Primary validation:

    • Dose-response relationships in Mrgpra7-expressing cells

    • Competition binding assays with known ligands

    • Absence of activity in cells lacking Mrgpra7 expression

  • Secondary validation:

    • Structure-activity relationship studies

    • Analysis of downstream signaling pathway activation

    • Receptor internalization assays

    • Biased signaling analysis

  • Tertiary validation:

    • Ex vivo tissue preparations (e.g., dorsal root ganglia)

    • In vivo validation in appropriate mouse models

    • Cross-reactivity testing with related Mrgpr family members

  • Data analysis and reporting:

    • Calculate EC50/IC50 values using appropriate curve-fitting

    • Determine binding affinities through Scatchard analysis or similar methods

    • Report data in standardized formats with complete methodology

This multi-tiered approach helps ensure that identified ligands are specific, potent, and physiologically relevant.

What are the most effective techniques for analyzing Mrgpra7 structure-function relationships?

Analyzing Mrgpra7 structure-function relationships requires an integrated approach combining computational and experimental methods:

  • Computational approaches:

    • Homology modeling based on related GPCR crystal structures

    • Molecular dynamics simulations to study receptor dynamics

    • In silico docking studies to predict ligand binding sites

    • Evolutionary analysis to identify conserved functional domains

  • Mutagenesis strategies:

    • Alanine scanning of predicted binding pockets and signaling interfaces

    • Conservative vs. non-conservative mutations to analyze specific residue properties

    • Chimeric receptors with related Mrgprs to identify functional domains

    • Truncation mutants to define roles of N-terminus, loops, and C-terminus

  • Functional analysis of mutants:

    • Ligand binding assays to assess affinity changes

    • Calcium mobilization or other signaling assays to assess functional impact

    • Trafficking studies to evaluate cell surface expression

    • Conformational studies using conformationally-sensitive antibodies

  • Advanced structural approaches:

    • Cysteine accessibility methods to probe structural features

    • Crosslinking studies to identify proximity relationships

    • Site-specific fluorescence studies to monitor conformational changes

    • Nuclear magnetic resonance (NMR) of receptor fragments when feasible

These approaches should be applied iteratively, with computational predictions guiding experimental design and experimental findings refining computational models.

How should I approach conflicting results in Mrgpra7 research?

When confronting conflicting results in Mrgpra7 research, follow this systematic framework:

  • Methodological analysis:

    • Compare experimental conditions between conflicting studies

    • Identify differences in cell types, assay conditions, or reagents

    • Evaluate antibody specificity and validation approaches

    • Assess the reproducibility metrics in each study

  • Biological context evaluation:

    • Consider species differences (mouse vs. human homologs)

    • Analyze cell type-specific effects (neurons vs. immune cells)

    • Assess the impact of physiological state or disease models

    • Evaluate potential compensatory mechanisms in knockout models

  • Resolution approaches:

    • Design experiments that directly address the discrepancy

    • Include positive and negative controls that can validate each conflicting result

    • Employ multiple complementary techniques to triangulate findings

    • Consider collaborative work with labs reporting conflicting data

  • Reporting conflicts transparently:

    • Acknowledge conflicting literature in manuscripts

    • Discuss possible reasons for discrepancies

    • Present a balanced view of competing hypotheses

    • Suggest experimental approaches to resolve conflicts in future work

This structured approach helps transform conflicting results from obstacles into opportunities for deeper understanding of Mrgpra7 biology.

What statistical approaches are most appropriate for analyzing Mrgpra7 functional data?

Selecting appropriate statistical approaches for Mrgpra7 functional data depends on your experimental design and data characteristics:

Data TypeRecommended Statistical ApproachesImportant Considerations
Dose-responseNon-linear regression, EC50/IC50 calculationTest for plateaus, Hill coefficient analysis
Time-courseRepeated measures ANOVA, Area under curve analysisAccount for baseline shifts, temporal autocorrelation
Multiple treatment groupsOne-way ANOVA with appropriate post-hoc testsCorrect for multiple comparisons (Bonferroni, Tukey)
Correlation studiesPearson/Spearman correlation, regression analysisTest for linearity assumptions, outlier influence
Gene expressionΔΔCT methods, normalization to housekeeping genesValidate reference gene stability across conditions

For all analyses:

How can I integrate Mrgpra7 findings with broader neuroimmune signaling research?

Integrating Mrgpra7 findings into the broader neuroimmune signaling context requires:

  • Comparative analysis with related receptors:

    • Create detailed comparison tables of Mrgpra7 with other Mrgpr family members

    • Map shared and unique signaling pathways across receptor subtypes

    • Identify convergent physiological outputs despite divergent mechanisms

  • Systems biology approaches:

    • Network analysis of Mrgpra7 interactors and signaling components

    • Pathway enrichment analysis to identify biological processes

    • Integration of transcriptomic, proteomic, and functional data

  • Translational considerations:

    • Correlate mouse Mrgpra7 findings with human MRGPRX2 studies

    • Identify conserved vs. species-specific mechanisms

    • Develop translational models bridging basic and clinical research

  • Multi-omics integration:

    • Combine transcriptomics of Mrgpra7-expressing cells

    • Integrate proteomics of signaling complexes

    • Analyze metabolomic changes following receptor activation

    • Correlate with functional outcomes in relevant disease models

  • Collaborative framework:

    • Establish collaborations with specialists in complement areas

    • Participate in consortia focused on neuroimmune signaling

    • Contribute to shared data repositories to facilitate meta-analyses

This integrated approach helps position Mrgpra7 findings within the broader context of neuroimmune communication systems and enhances their translational potential.

What are the major technical challenges in Mrgpra7 research?

Current technical challenges in Mrgpra7 research include:

  • Receptor-specific tools:

    • Limited availability of highly selective antibodies

    • Need for more specific agonists and antagonists

    • Challenges in distinguishing from closely related family members

  • Physiological relevance:

    • Difficulty in establishing endogenous ligand concentrations in vivo

    • Understanding receptor function in native tissue contexts

    • Connecting in vitro findings to in vivo phenotypes

  • Methodology limitations:

    • Challenges in receptor crystallization for structural studies

    • Technical difficulties in measuring real-time signaling in primary cells

    • Limitations in current animal models for functional validation

To address these challenges, researchers should:

  • Develop and validate new receptor-specific tools

  • Employ CRISPR-based approaches for endogenous tagging

  • Establish improved physiological assay systems

  • Consider advanced imaging techniques for in vivo studies

How might single-cell approaches advance our understanding of Mrgpra7 biology?

Single-cell approaches offer powerful new avenues for understanding Mrgpra7 biology:

  • Single-cell transcriptomics:

    • Precisely define cell populations expressing Mrgpra7

    • Identify co-expression patterns with other receptors and signaling molecules

    • Characterize transcriptional responses to receptor activation at single-cell resolution

  • Single-cell proteomics:

    • Quantify Mrgpra7 protein expression in individual cells

    • Measure correlation between transcript and protein levels

    • Assess post-translational modifications in different cell states

  • Functional single-cell assays:

    • Single-cell calcium imaging to assess heterogeneity in responses

    • Patch-clamp electrophysiology to link receptor activation to neuronal firing

    • Microfluidic platforms for controlled single-cell stimulation and analysis

  • Spatial transcriptomics/proteomics:

    • Map Mrgpra7 expression in tissue contexts with spatial resolution

    • Connect receptor expression to microanatomical features

    • Analyze receptor distribution in health vs. disease states

These approaches will help resolve cell-to-cell heterogeneity in Mrgpra7 expression and function, potentially revealing specialized roles in subpopulations that are masked in bulk analyses.

What novel experimental paradigms might advance Mrgpra7 research in the coming years?

Emerging experimental paradigms likely to advance Mrgpra7 research include:

  • Advanced genetic models:

    • Conditional and inducible Mrgpra7 knockout models

    • Knock-in reporter mice for live imaging

    • Humanized mouse models expressing human MRGPRX2 in place of mouse Mrgpra7

  • Cutting-edge imaging techniques:

    • Optogenetic tools coupled to Mrgpra7 signaling

    • FRET-based biosensors for real-time signaling in vivo

    • Light-sheet microscopy for whole-tissue receptor dynamics

  • Synthetic biology approaches:

    • Engineered cells with defined signaling components

    • Designer receptors based on Mrgpra7 scaffolds

    • Biosensor development for ligand detection in complex samples

  • Organ-on-chip technology:

    • Microfluidic platforms modeling neuroimmune interactions

    • Co-culture systems with defined cell populations

    • Controlled microenvironments mimicking physiological conditions

  • Computational methods:

    • Deep learning for image analysis and pattern recognition

    • Molecular dynamics simulations at extended timescales

    • In silico screening of virtual compound libraries

These innovative approaches will help overcome current limitations and provide new insights into Mrgpra7 biology, potentially revealing novel therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.