Recombinant Mouse Mas-related G-protein coupled receptor member A8 (Mrgpra8)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Mrgpra8 (MAS-related GPR member A8) is a Class A GPCR expressed in nociceptive sensory neurons. It lacks conserved activation motifs (e.g., CWxP, DRY) found in canonical GPCRs, leading to unique ligand-binding and signaling properties . Key features include:

  • Gene ID: 404237 (Mouse)

  • Protein Length: 305 amino acids (full-length)

  • Host Systems: Produced in mammalian cells, E. coli, yeast, or baculovirus

  • Purity: ≥85% as verified by SDS-PAGE

Neuropathic Pain Pathways

Mrgpra8 interacts with TRP-A1 to amplify mechanical hypersensitivity in dorsal root ganglia (DRG). Inhibition reduces neuropathic pain in murine models .

Non-Histaminergic Itch Signaling

  • Ligands: β-alanine, PAMP9–20, compound 48/80 .

  • Mechanism: Activates Gi proteins, triggering Ca²⁺ influx in sensory neurons distinct from IgE-mediated pathways .

  • Neuronal Overlap: Co-activates subsets of neurons responsive to chloroquine (Mrgpra3) and serotonin .

Immune Modulation

Mrgpra8+ mast cells release tryptase and recruit neutrophils during bacterial infections (e.g., S. aureus) .

Table 2: Key Assays and Reagents

ApplicationProduct TypeSupplier
Protein ExpressionRecombinant ProteinMyBioSource, Creative BioMart
Functional StudiesELISA KitAbbexa
In Vivo AnalysisMrgpra8-Cre;tdT MiceGenerated via CRISPR

Research Limitations and Future Directions

  • Ligand Specificity: Endogenous ligands beyond β-alanine remain poorly characterized .

  • Structural Data: Only two cryo-EM structures (β-alanine-bound and apo states) exist, limiting mechanistic insights .

  • Therapeutic Potential: Small-molecule modulators are under development for pain and inflammatory disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mrgpra8; Mrga8; Mas-related G-protein coupled receptor member A8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mrgpra8
Target Protein Sequence
MDKTILGSIDIETLIRHLMIIIFGLVGLTGNAIVFWLLGFHLHRNAFLVYILNLALADFF YLLCHIINSIMFLLKVPSPNIILDHCFYTIMIVLYITGLSMLSAISTERCLSVLCPIWYR CHRPEHTSTAMCAVIWVMSLLISILNGYFCNFSSPKYVNNSVCQASDIFIRTYPIFLFVL LCLSTLALLARLFSGAGKRKFTRLFVTIMLAILVFLLCGLPLGFFWFLSPWIEDRFIVLD YRLFFASVVLTVVNSCANPIIYFFVGSFRHRLKQQTLKMFLQRALQDTPETPENMVEMSR SKAEP
Uniprot No.

Target Background

Function

Orphan receptor. May function as a receptor for RFamide-family neuropeptides, such as NPFF and NPAF, which exhibit analgesic effects in vivo. It may regulate nociceptor function and/or development, influencing pain sensation and/or modulation.

Database Links

KEGG: mmu:404237

UniGene: Mm.297430

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons that includes nociceptors. Expressed in the subclass of non-peptidergic sensory neurons that are IB4(+) and VR1(-).

Q&A

What is the molecular function of Mrgpra8 in mouse sensory neurons?

Mrgpra8 belongs to the Mas-related G-protein coupled receptor (Mrgpr) family, a group of receptors primarily expressed in sensory neurons. While specific Mrgpra8 functions are still being elucidated, research on related receptors like MrgprA3 indicates these receptors play crucial roles in pruriceptive (itch-sensing) neurons. MrgprA3+ neurons specifically exhibit enrichment for itch sensation, membrane hyperpolarization, and ATP response pathways . As part of the same family, Mrgpra8 likely contributes to similar sensory neuron functions, potentially with specialized ligand recognition patterns distinct from other family members.

How does Mrgpra8 gene expression compare to other Mrgpr family members in different tissue types?

Mrgpra8 expression patterns share similarities with other Mrgpr family members but with distinct tissue distribution. Based on research on related receptors like MrgprA3, these receptors are predominantly expressed in specific subpopulations of dorsal root ganglion (DRG) sensory neurons. MrgprA3+ neurons show enrichment for neurotrophin receptors including Gfra1 (GDNF receptor alpha 1) and Ntrk1 (TrkA) . Mrgpra8 likely exhibits a similarly specialized expression pattern, potentially with unique neuronal subtype localization that distinguishes it from other family members.

What experimental approaches are recommended for initial characterization of Mrgpra8 function?

Initial characterization of Mrgpra8 function should include:

  • Expression analysis: RNA-seq and qPCR to determine tissue-specific expression patterns

  • Functional assays: Calcium imaging to measure receptor activation responses

  • Genetic approaches: CRISPR/Cas9-mediated knockout using targeted gRNAs

  • Behavioral testing: Assessment of sensory responses in knockout models

  • Comparative analysis: Evaluation alongside other Mrgpr family members

For genetic manipulation experiments, lentiviral CRISPR systems with a titer of >1×10^7 IU/mL carrying specific gRNAs against Mrgpra8 provide efficient tools for receptor knockout studies . These systems typically utilize the pLenti-U6-sgRNA-PGK-Neo vector backbone with U6 and PGK promoters driving gRNA expression and selection marker expression, respectively.

What are the optimal approaches for differentiating between Mrgpra8 and other closely related Mrgpr family receptors in functional studies?

Distinguishing Mrgpra8 from other closely related Mrgpr receptors requires multi-faceted approaches:

  • Pharmacological profiling:

    • Use selective agonists/antagonists with validated selectivity margins

    • Implement dose-response experiments with control compounds

    • Conduct competitive binding assays to determine receptor specificity

  • Genetic discrimination:

    • Apply targeted CRISPR/Cas9 genome editing with highly specific gRNAs

    • Utilize conditional knockout models to avoid developmental compensation

    • Implement single-cell transcriptomics to identify receptor co-expression patterns

  • Bioinformatic analysis:

    • Conduct sequence alignment of binding domains across Mrgpr subtypes

    • Perform phylogenetic analysis to establish evolutionary relationships

    • Use structural modeling to predict ligand binding site differences

Researchers should validate their observations through multiple independent approaches, as receptor cross-reactivity remains a significant challenge in this field.

How can researchers effectively analyze transcriptional changes in Mrgpra8-expressing neurons following peripheral stimulation?

Analyzing transcriptional changes in Mrgpra8-expressing neurons requires sophisticated methodological approaches:

  • Single-cell isolation strategy:

    • Use fluorescence-activated cell sorting (FACS) to isolate Mrgpra8+ neurons

    • Employ reporter mouse lines with fluorescent protein expression driven by the Mrgpra8 promoter

    • Implement laser capture microdissection for spatial precision

  • Transcriptional analysis workflow:

    • Conduct RNA-seq with low-input protocols for small neuron populations

    • Apply Principal Component Analysis (PCA) to distinguish neuronal subpopulations

    • Utilize support vector machine (SVM)-based classification models to quantify treatment effects

  • Validation approaches:

    • Confirm key findings with qPCR on independently isolated samples

    • Perform in situ hybridization to validate spatial expression patterns

    • Use pathway enrichment analysis (GO terms) to identify functional clusters

This systematic approach allows researchers to comprehensively characterize transcriptional responses while controlling for technical and biological variability.

What methodological considerations are crucial when designing experiments to study Mrgpra8 involvement in itch sensation?

When designing experiments to study Mrgpra8's role in itch sensation, researchers should consider:

  • Animal model selection:

    • Use genetically modified models with cell-type specific Mrgpra8 manipulation

    • Consider developmental timing of receptor expression

    • Control for strain-specific differences in sensory responses

  • Behavioral assay design:

    • Implement multiple pruritogen compounds to test receptor specificity

    • Quantify scratching behavior using automated systems for objectivity

    • Include appropriate controls for pain/tactile sensation to distinguish modalities

  • Molecular intervention approaches:

    • Apply lentiviral CRISPR/Cas9 systems for targeted manipulation

    • Consider inducible expression systems to control temporal aspects

    • Use multiple gRNA targeting strategies to ensure complete knockout

  • Experimental controls:

    • Include wild-type littermates as genetic controls

    • Perform sham procedures to control for manipulation effects

    • Test multiple pruritogens with distinct mechanisms to establish specificity

These methodological considerations help establish causality between Mrgpra8 function and pruriceptive responses while controlling for potential confounding factors.

What are the optimal parameters for developing stable cell lines expressing recombinant Mrgpra8?

Development of stable cell lines expressing recombinant Mrgpra8 requires careful optimization:

  • Vector selection considerations:

    • Choose expression vectors with strong promoters (CMV or EF1α)

    • Include selection markers (neomycin resistance) for stable integration

    • Consider inducible expression systems for receptors that may affect cell viability

  • Cell line selection criteria:

    • HEK293 cells typically provide robust expression for GPCRs

    • CHO cells offer advantages for functional coupling studies

    • Neuronal cell lines may provide more physiologically relevant contexts

  • Transfection optimization:

    • Compare lipid-based, electroporation and viral transduction methods

    • Optimize cell density (typically 70-80% confluence)

    • Establish selection protocols with appropriate antibiotic concentrations

  • Validation requirements:

    • Confirm expression by Western blot, immunofluorescence, and RT-PCR

    • Verify membrane localization through surface biotinylation

    • Test functional coupling through calcium imaging or cAMP assays

  • Cell maintenance protocols:

    • Maintain selection pressure with appropriate antibiotic concentrations

    • Establish early passage stocks to prevent genetic drift

    • Periodically verify receptor expression levels

This systematic approach ensures consistent receptor expression for reliable experimental outcomes.

How can researchers effectively analyze heterochromatin regulation affecting Mrgpra8 expression?

Analysis of heterochromatin regulation affecting Mrgpra8 expression requires specialized approaches:

  • Chromatin accessibility analysis:

    • Implement ATAC-seq to identify accessible chromatin regions at the Mrgpra8 locus

    • Perform DNase-seq to map hypersensitive sites indicating active regulatory regions

    • Use ChIP-seq for histone modifications (H3K9me3, H3K27me3) associated with heterochromatin

  • DNA methylation profiling:

    • Apply bisulfite sequencing to map methylation patterns at the Mrgpra8 promoter

    • Perform methylated DNA immunoprecipitation (MeDIP) to assess broad methylation changes

    • Use targeted pyrosequencing for quantitative analysis of specific CpG sites

  • Regulatory factor identification:

    • Conduct ChIP-seq for heterochromatin proteins (HP1, Setdb1, Trim28)

    • Perform motif analysis to identify potential binding sites for repressive factors

    • Use proteomic approaches to identify proteins bound to the Mrgpra8 locus

  • Functional validation:

    • Apply CRISPR/Cas9-mediated epigenome editing to modify specific regulatory elements

    • Use reporter assays to test the activity of putative regulatory regions

    • Implement genetic knockout of chromatin modifiers to assess their impact on Mrgpra8 expression

These approaches provide comprehensive insight into heterochromatin-mediated regulation of Mrgpra8 expression.

How can researchers address potential off-target effects when using CRISPR-Cas9 to modify Mrgpra8 expression?

Addressing off-target effects in CRISPR-Cas9 modification of Mrgpra8 requires systematic approaches:

  • Guide RNA design optimization:

    • Use validated computational tools to predict off-target sites

    • Select guides with minimal homology to other genomic regions

    • Design multiple gRNAs targeting different Mrgpra8 regions

  • Experimental validation protocols:

    • Perform whole-genome sequencing to identify potential off-target modifications

    • Use T7 endonuclease assays to detect mismatches at predicted off-target sites

    • Implement control experiments with scrambled gRNAs

  • Alternative strategies:

    • Consider high-fidelity Cas9 variants (eSpCas9, SpCas9-HF1)

    • Use paired nickase approaches to increase specificity

    • Implement inducible or tissue-specific Cas9 expression systems

  • Validation approaches:

    • Generate multiple independent knockout lines for phenotypic comparison

    • Perform rescue experiments with wild-type Mrgpra8 expression

    • Conduct RNA-seq to assess transcriptome-wide effects

What strategies can resolve inconsistent functional data when studying Mrgpra8 signaling pathways?

When facing inconsistent functional data in Mrgpra8 signaling studies, consider these resolution strategies:

  • Methodological standardization:

    • Establish consistent experimental conditions (cell density, passage number)

    • Standardize reagent preparation and storage protocols

    • Implement detailed documentation of experimental procedures

  • Technical validation approaches:

    • Use multiple assay readouts (calcium imaging, BRET, FRET)

    • Implement positive controls with well-characterized GPCRs

    • Conduct dose-response experiments across wider concentration ranges

  • Biological factors assessment:

    • Evaluate receptor expression levels across experimental systems

    • Test for endogenous expression of interfering receptors or signaling molecules

    • Consider cell type-specific factors that might influence coupling efficiency

  • Data analysis refinement:

    • Apply appropriate statistical methods for variability assessment

    • Identify and address potential outliers through robust statistical approaches

    • Consider hierarchical modeling to account for batch effects

  • Cross-validation strategies:

    • Compare results across different experimental platforms

    • Validate key findings in primary cells or tissues

    • Collaborate with independent laboratories for replication

What emerging technologies show the most promise for elucidating Mrgpra8's role in neuronal subpopulation functioning?

Several emerging technologies show particular promise for advancing Mrgpra8 research:

  • Single-cell multi-omics approaches:

    • Integrated single-cell RNA-seq and ATAC-seq to correlate expression with chromatin states

    • Spatial transcriptomics to map Mrgpra8 expression in tissue context

    • Single-cell proteomics to identify co-expressed signaling components

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize receptor localization and clustering

    • In vivo calcium imaging to monitor Mrgpra8+ neuron activity in response to stimuli

    • Optogenetic tools for precise temporal activation of Mrgpra8+ neurons

  • Novel genetic engineering approaches:

    • CRISPR-based activation/repression systems for temporal control of Mrgpra8 expression

    • Base editing technologies for precise modification of Mrgpra8 coding sequences

    • Lineage tracing methods to track the development of Mrgpra8+ neuronal populations

  • Computational methods:

    • Machine learning approaches for pattern recognition in complex sensory neuron datasets

    • Structural modeling to predict ligand-receptor interactions

    • Network analysis to position Mrgpra8 within broader signaling pathways

These technologies, particularly when used in combination, offer unprecedented opportunities to dissect Mrgpra8's functional role in neuronal subpopulations.

How might comparative analysis between mouse and human Mrgpr family members inform translational research efforts?

Comparative analysis between mouse and human Mrgpr family members offers valuable insights for translational research:

  • Evolutionary and structural comparison approaches:

    • Perform phylogenetic analysis to identify orthologous relationships

    • Conduct sequence alignment focusing on ligand binding domains

    • Use structural modeling to compare receptor architecture across species

  • Functional conservation assessment methods:

    • Develop parallel assay systems for mouse and human receptors

    • Test cross-species ligand recognition profiles

    • Compare signaling pathway coupling between orthologous receptors

  • Tissue expression pattern analysis:

    • Compare single-cell transcriptomics data across species

    • Evaluate developmental timing of receptor expression

    • Assess co-expression patterns with conserved neuronal markers

  • Translational implications assessment:

    • Identify species-specific differences that might affect drug development

    • Evaluate potential compensatory mechanisms in each species

    • Develop humanized mouse models expressing human Mrgpr variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.