Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

Mrgprb2 is a mast cell-specific receptor that binds cationic ligands such as neuropeptides (e.g., substance P), antimicrobial peptides, and drugs (e.g., ciprofloxacin) . Activation triggers mast cell degranulation, releasing histamine, chymase (MCPT4), and proteases, which drive vascular hyperpermeability, itch, and inflammation . Unlike IgE-mediated pathways, Mrgprb2 activation induces non-histaminergic itch and pseudo-allergic reactions .

Key Pathways:

  • Sensory Neuron-Mast Cell Crosstalk: Substance P from dorsal root ganglion neurons activates Mrgprb2, releasing chymase, which further stimulates neuronal SP release—a cyclic amplification loop .

  • Matrix Metalloprotease (MMP) Regulation: Mrgprb2 activation disrupts MMP-TIMP balances, altering bladder wall biomechanics and compliance .

Research Applications and Assay Systems

Recombinant Mrgprb2 is critical for in vitro and in vivo studies of mast cell-driven inflammation. Commercial ELISA kits (detection range: 15.6–1,000 pg/ml; sensitivity: 9.375 pg/ml) enable quantitative analysis in serum, plasma, and tissue lysates .

Assay ParameterSpecification
Detection MethodSandwich ELISA, colorimetric
Sample TypesSerum, plasma, cell culture supernatants, tissue homogenates
Sensitivity9.375 pg/ml (XpressBio) ; <0.07 ng/ml (Abbexa)
ApplicationsMast cell degranulation studies, inflammatory disease models, drug screens

Vascular Permeability and Inflammation

  • Mrgprb2 activation in peritoneal mast cells releases histamine and MCPT4, directly increasing vascular permeability. Antihistamines and chymase inhibitors suppress this effect .

  • Compound 48/80 (Mrgprb2 agonist) induces rapid bladder wall compliance changes via MMP-2/TIMP-2 imbalance, independent of mast cells .

Therapeutic Implications

  • TRPV1 Antagonists: Block substance P release from sensory neurons, reducing Mrgprb2-driven inflammation .

  • Chymase Inhibitors: Mitigate vascular hyperpermeability and inflammation in murine models .

Challenges and Future Directions

  • Species-Specific Differences: Human MRGPRX2 has lower ligand EC₅₀ values than murine Mrgprb2, complicating translational studies .

  • Mast Cell Heterogeneity: Mrgprb2 is absent in mucosal mast cells (MMCs), limiting its role to connective tissue mast cells (CTMCs) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Mrgprb2; Mrgb2; Mas-related G-protein coupled receptor member B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mrgprb2
Target Protein Sequence
MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSIIISLVGMGLNAIVLW FLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSIDINIPLVLYVVPIFAY LSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVMSLLLGLLEGKACGLLFN SFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQRIPMTRLYVTITLTVLVFL IFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCMNPIIYFLVGSIRHRRFRRK TLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS
Uniprot No.

Target Background

Function
Mas-related G-protein coupled receptor member B2 (Mrgprb2) is a mast cell-specific receptor that recognizes basic secretagogues. These secretagogues include cationic amphiphilic drugs, as well as endo- or exogenous peptides, characterized by a basic head group and a hydrophobic core. Mrgprb2 specifically binds small molecules containing a cyclized tetrahydroisoquinoline (THIQ), such as non-steroidal neuromuscular blocking drugs (NMBDs), including tubocurarine and atracurium. Upon binding these compounds, Mrgprb2 mediates pseudo-allergic reactions. These reactions are characterized by histamine release, inflammation, and airway contraction.
Gene References Into Functions
  1. Basic secretagogues activate mouse mast cells in vitro and in vivo through a single receptor, Mrgprb2, the orthologue of the human G-protein-coupled receptor MRGPRX2. PMID: 25517090
Database Links

KEGG: mmu:243979

UniGene: Mm.83689

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Mast cell-specific.

Q&A

What is Mrgprb2 and what is its functional significance in mice?

Mrgprb2 (Mas-related G-protein coupled receptor member B2) is a G-protein coupled receptor selectively expressed on mouse mast cells that mediates IgE-independent, "pseudo-allergic" mast cell activation. This receptor serves as the mouse homologue of human MRGPRX2, sharing approximately 53% amino acid sequence identity . Functionally, Mrgprb2 plays critical roles in:

  • Regulating mast cell degranulation independently of the canonical FcεRI pathway

  • Recruiting immune cells (particularly neutrophils) during inflammatory responses

  • Modulating host defense against microbial infection

  • Participating in neurogenic inflammation through interactions with substance P-positive nerve fibers

Recent research indicates that Mrgprb2 signaling is essential for mounting appropriate responses to tissue damage, particularly in the context of intestinal inflammation and barrier protection .

How does Mrgprb2 compare to its human ortholog MRGPRX2?

ParameterMRGPRX2 (Human)Mrgprb2 (Mouse)Comparative Difference
Substance P EC50LowerHigher~360-fold lower for MRGPRX2
Rocuronium EC50HigherLower~12-fold higher for MRGPRX2
Expression patternConnective tissue-type MCsConnective tissue-type MCsSimilar tissue distribution
Genetic variantsSeveral SNPs identified (e.g., rs10833049)N/AHuman variants linked to UC susceptibility

These differences are attributed to the relatively low amino acid sequence identity between the receptors, which has important implications for translational research and drug development targeting this pathway .

What experimental methods are commonly employed to study Mrgprb2 function?

Several complementary approaches are used to investigate Mrgprb2 biology:

  • Genetic models: Mrgprb2 knockout (b2KO) mice and mice with mast cell-specific deletion of β-arrestin 2

  • Disease models: Dextran sulfate sodium (DSS)-induced colitis and IgE-mediated allergic airway inflammation models

  • Cell culture systems:

    • Peritoneal mast cell (PMC) cultures for ex vivo studies

    • RBL-2H3 cells stably expressing MRGPRX2 for comparative studies

    • HTLA cells and MRGPRX2-Tango expressing cells for signaling studies

  • Analytical techniques:

    • Advanced microscopic imaging with genetic labeling strategies

    • Flow cytometry for immune cell profiling

    • qPCR for cytokine/chemokine expression analysis

    • 16S rRNA sequencing for microbiota analysis

How does Mrgprb2 deficiency affect DSS-induced colitis progression?

Contrary to initial expectations, Mrgprb2 knockout (b2KO) mice exhibit significantly exacerbated DSS-induced colitis compared to wild-type counterparts. This paradoxical effect manifests as:

  • Increased weight loss, higher disease activity index scores, and more severe colon shortening

  • More extensive colonic pathological damage

  • Decreased mast cell activation and reduced inflammatory cell infiltration

  • Attenuated expression of neutrophil-attracting cytokines (CCL3, CCL4, CCL5, CXCL1, and CXCL2)

  • Impaired neutrophil recruitment to sites of inflammation

These findings suggest that Mrgprb2-mediated signaling plays a protective role in colitis by facilitating appropriate neutrophil recruitment and inflammatory responses that limit excessive tissue damage. Loss of Mrgprb2 signaling prevents the mounting of an appropriate colonic damage response, leading to more severe disease progression .

What mechanisms underlie Mrgprb2's regulation of intestinal barrier function?

Mrgprb2 appears to protect intestinal barrier integrity through several interconnected mechanisms:

  • Maintenance of tight junction proteins: b2KO mice show attenuated expression of occludin, a critical tight junction protein essential for barrier function

  • Mucin production regulation: Expression of mucin-2, a key component of the intestinal mucus layer, is significantly reduced in Mrgprb2-deficient mice

  • Modulation of microbiota composition: Mrgprb2 signaling helps maintain beneficial bacteria such as Lactobacillus while controlling potential pathogens like Escherichia-Shigella

  • Neutrophil recruitment: Mrgprb2 activation triggers production of neutrophil-attracting cytokines that facilitate pathogen clearance

  • Neuroimmune signaling: The receptor participates in substance P-mediated neuroimmune communication that supports epithelial repair processes

These mechanisms collectively contribute to Mrgprb2's protective effects on intestinal barrier function during inflammatory insults, explaining why Mrgprb2-deficient mice experience more severe barrier disruption during colitis .

How does Mrgprb2 signaling coordinate neutrophil recruitment during inflammation?

Mrgprb2 orchestrates neutrophil recruitment through a carefully coordinated process:

  • Cytokine/chemokine induction: When activated by ligands such as substance P (50 μM), Mrgprb2+ mast cells markedly upregulate expression of neutrophil-recruiting cytokines, including CXCL1 and CXCL2

  • Directional migration: In vivo experiments demonstrate that intraperitoneal administration of Mrgprb2 ligands leads to substantial neutrophil influx into the peritoneal cavity of wild-type mice but minimal recruitment in Mrgprb2-deficient animals

  • Temporal regulation: During DSS-induced colitis, Mrgprb2 signaling ensures appropriate neutrophil recruitment during the active damage phase (days 5-7), with expression of CCL3, CCL4, CCL5, CXCL1, and CXCL2 markedly attenuated in b2KO mice

  • Tissue-specific effects: Mrgprb2+ mast cells appear concentrated in the distal colon, where they increase dramatically during acute colitis and are found in close association with substance P-positive nerve fibers

This coordinated response allows for precise regulation of neutrophil-mediated inflammation, contributing to pathogen clearance while preventing excessive tissue damage .

What distinguishes Mrgprb2-mediated from FcεRI-mediated mast cell activation?

These two pathways represent fundamentally different mechanisms of mast cell activation:

FeatureFcεRI-mediatedMrgprb2-mediated
DependencyAntigen-specific IgE bindingIgE-independent
Immune system involvementRequires adaptive immune systemInnate response
Activation triggersAntigen cross-linking of IgENeuropeptides, host defense peptides, cationic drugs
Terminology"Allergic" activation"Pseudo-allergic" activation
KineticsTypically slower, requiring sensitizationCan be rapid, no prior sensitization needed
Downstream signalingβ-arrestin-dependent and independentStrong β-arrestin component
Cytokine profileClassic allergic cytokines (IL-4, IL-13)Includes neutrophil-attracting chemokines

In allergic airway inflammation, these pathways appear to work synergistically, with substance P-mediated Mrgprb2 activation contributing to inflammation and goblet cell hyperplasia while β-arrestin 2 promotes mast cell recruitment to facilitate their activation through FcεRI .

How does Mrgprb2 participate in neuroimmune interactions in inflammatory contexts?

Mrgprb2 serves as a critical mediator in a newly identified neuroimmune axis:

  • During acute DSS colitis, there is a pronounced increase in Mrgprb2-expressing mast cells, which are found in close association with substance P-positive nerve fibers

  • Substance P (SP), released by sensory neurons in response to tissue damage or inflammatory stimuli, directly activates Mrgprb2 on mast cells

  • This activation triggers mast cell degranulation and release of inflammatory mediators independent of IgE/FcεRI pathways

  • The SP-Mrgprb2 axis represents a previously unconsidered colonic neuroimmune pathway with significant potential for therapeutic targeting

  • In allergic airway inflammation models, this neuroimmune signaling pathway contributes significantly to inflammatory processes and tissue remodeling

This mechanism appears particularly important in mucosal tissues such as the gastrointestinal tract and airways, where mast cells are positioned near nerve endings and can rapidly respond to neurogenic signals during inflammation .

How does Mrgprb2 influence gut microbiota composition and function?

Mrgprb2 plays a significant role in shaping the intestinal microbiome:

  • In Mrgprb2 knockout mice with DSS-induced colitis, both the abundance and diversity of intestinal microbiota are significantly reduced

  • These mice show specific alterations in microbial communities:

    • Decreased levels of beneficial bacteria, including norank_f_Muribaculaceae and Lactobacillus

    • Increased abundance of potentially harmful bacteria like Escherichia-Shigella

  • Mrgprb2 appears to be a component of the microbiota-gut-brain axis, which is disturbed in ulcerative colitis patients

  • The receptor may help mast cells respond to microbial signals and coordinate appropriate immune responses

  • These microbiota changes likely contribute to the exacerbated colitis observed in Mrgprb2-deficient mice by reducing colonization resistance and microbial metabolite production

What methodological considerations are important when designing Mrgprb2 functional studies?

Researchers should consider several critical factors when investigating Mrgprb2:

  • Model selection: Choose appropriate models based on research questions:

    • For basic signaling studies: Cell culture systems with controlled expression

    • For in vivo significance: Genetic knockout models in disease contexts

    • For translational relevance: Comparative studies with human MRGPRX2

  • Ligand considerations:

    • Account for species differences in ligand potency (e.g., substance P is ~360-fold more potent at human MRGPRX2 than mouse Mrgprb2)

    • Use appropriate concentrations based on receptor sensitivity (50 μM substance P for mouse Mrgprb2 studies)

    • Consider receptor cross-reactivity with other GPCR family members

  • Readout selection:

    • For activation studies: Measure calcium mobilization, degranulation markers, and β-arrestin recruitment

    • For inflammatory models: Assess cytokine/chemokine expression, immune cell recruitment, and tissue pathology

    • For barrier studies: Evaluate tight junction proteins, mucin expression, and microbiota composition

  • Timing considerations:

    • In DSS colitis models, examine both active damage phase (days 5-7) and recovery periods

    • Account for potential compensatory mechanisms in constitutive knockout models

What are the therapeutic implications of targeting Mrgprb2/MRGPRX2 in inflammatory disorders?

Recent findings suggest significant therapeutic potential for this pathway:

  • A common loss-of-function SNP in human MRGPRX2 (rs10833049, N62S variant) is significantly enriched in a Jewish population with 4-fold increased prevalence of ulcerative colitis, linking impaired MRGPRX2 signaling to UC pathophysiology

  • Small molecule inhibitors that attenuate MRGPRX2-mediated responses in human mast cells have been shown to also block Mrgprb2-mediated responses in vivo, suggesting potential for cross-species drug development

  • Natural compounds like osthole (a plant coumarin) can inhibit MRGPRX2-mediated degranulation and may represent starting points for drug discovery

  • MRGPRX2 has been implicated in various conditions beyond UC, including mastocytosis, neurogenic inflammation, chronic urticaria, chronic prurigo, rosacea, atopic dermatitis, and allergic contact dermatitis/itch

  • The discovery of the SP-Mrgprb2 neuro-immune axis opens novel research avenues for pseudo-allergic mast cell activation in UC and other GI-related conditions with known mast cell involvement

These findings collectively highlight Mrgprb2/MRGPRX2 as a promising target for developing novel therapeutics for inflammatory disorders, particularly those involving mast cell activation and neuroimmune signaling .

What are the recommended methods for detecting and quantifying Mrgprb2 expression?

Researchers employ several complementary techniques to accurately assess Mrgprb2 expression:

  • Genetic labeling strategies: Using reporter mice with fluorescent proteins under Mrgprb2 promoter control provides visualization of expression patterns in tissues

  • Immunohistochemistry/immunofluorescence: Using validated antibodies against Mrgprb2 to detect protein expression in tissue sections

  • Flow cytometry: For quantitative assessment of Mrgprb2 expression on mast cells in single-cell suspensions

  • Quantitative PCR: For measuring Mrgprb2 mRNA expression levels in tissues or sorted cell populations

  • Advanced microscopic imaging: To visualize Mrgprb2-expressing cells in relation to other tissue structures, such as nerve fibers

When implementing these methods, researchers should consider:

  • Appropriate controls (Mrgprb2-knockout tissues/cells)

  • Antibody validation to ensure specificity

  • Correlation of protein with mRNA expression data

  • Co-staining with mast cell markers (c-Kit, FcεRI) to confirm cell identity

How can researchers effectively model Mrgprb2-dependent mast cell activation in vitro?

Effective in vitro modeling of Mrgprb2 activation requires careful consideration of several factors:

  • Cell systems:

    • Primary peritoneal mast cells (PMCs) from wild-type and Mrgprb2-knockout mice provide physiologically relevant models

    • RBL-2H3 cells stably expressing Mrgprb2 offer a more controlled system for specific signaling studies

    • HTLA cells expressing Mrgprb2-Tango constructs allow for high-throughput screening of agonists/antagonists

  • Activation protocols:

    • Substance P stimulation (50 μM optimal for mouse Mrgprb2)

    • Host defense peptides as alternative physiological activators

    • Small molecule agonists for controlled activation studies

  • Readout assays:

    • Degranulation: β-hexosaminidase release assay

    • Calcium mobilization: Fluorescent calcium indicators

    • Cytokine/chemokine production: ELISA or qPCR analysis of CXCL1, CXCL2, CCL3, CCL4, CCL5

    • G-protein activation: BRET or FRET-based assays

    • β-arrestin recruitment: TANGO assay or bioluminescence-based methods

  • Controls:

    • IgE/antigen stimulation via FcεRI as a comparative control

    • Mrgprb2-knockout cells to confirm specificity

    • Pharmacological inhibitors to dissect signaling pathways

What are the key considerations when interpreting data from Mrgprb2 knockout models?

When analyzing results from Mrgprb2-deficient systems, researchers should account for:

  • Paradoxical phenotypes: Mrgprb2 knockout mice show exacerbated colitis but decreased inflammatory cell infiltration, highlighting the complex role of this receptor in coordinating appropriate immune responses rather than simply promoting or inhibiting inflammation

  • Compensatory mechanisms: Chronic absence of Mrgprb2 may lead to developmental adaptations in mast cell function or distribution that could influence experimental outcomes

  • Background strain effects: Genetic background of mice can significantly impact inflammation models and should be considered when comparing studies

  • Timing considerations: Differential effects may be observed during acute damage phase versus recovery phase in inflammatory models

  • Tissue-specific effects: Mrgprb2's role may vary between tissues based on local microenvironment and mast cell phenotype

  • System-wide changes: Effects on microbiota composition, barrier function, and neuroimmune interactions should be considered when interpreting primary phenotypes

  • Translational relevance: Findings should be cautiously interpreted in the context of human MRGPRX2 function, accounting for pharmacological differences between species

What are the emerging areas of investigation for Mrgprb2 biology?

Several promising research directions are emerging in the Mrgprb2 field:

  • Neuroimmune signaling: Further characterization of the SP-Mrgprb2 axis in various tissues and disease contexts, particularly exploring bidirectional communication between mast cells and neurons

  • Microbiome interactions: Deeper investigation of how Mrgprb2 signaling shapes microbiota composition and function, and reciprocally, how microbial metabolites might influence Mrgprb2 expression or activation

  • Tissue repair mechanisms: Exploring Mrgprb2's role in epithelial regeneration and barrier restoration following inflammatory damage

  • Drug development: Identification and optimization of selective Mrgprb2/MRGPRX2 modulators for therapeutic applications in inflammatory and allergic conditions

  • Genetic variation: Investigating how polymorphisms in human MRGPRX2 influence disease susceptibility and progression, building on observations linking certain variants to ulcerative colitis risk

  • Cross-talk with other pathways: Understanding how Mrgprb2 signaling interacts with other mast cell activation pathways, including FcεRI and Toll-like receptors

  • Structural biology: Determining crystal structures of Mrgprb2/MRGPRX2 to inform rational drug design and understand ligand binding mechanisms

These emerging areas represent exciting opportunities for researchers to advance understanding of Mrgprb2 biology and its therapeutic potential in inflammatory disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.