Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre) is a laboratory-engineered protein that replicates the native Mrgpre receptor found in mice. Mrgpre belongs to the Mas-related G protein-coupled receptor (MRGPR) family, which is involved in sensory signaling, immune responses, and neuro-immune interactions . The recombinant form enables controlled studies of its structure, ligand interactions, and functional roles in vitro and in vivo.

Functional Insights

Mrgpre is implicated in sensory and immune modulation:

  • Heterodimerization: Rat Mrgpre forms functional heterodimers with Mrgprd, altering β-alanine-induced calcium signaling and receptor internalization .

  • Ligand specificity: MRGPRs broadly recognize diverse ligands (e.g., peptides, small molecules), but Mrgpre’s endogenous ligands are not fully characterized.

Functional PropertyObservationSource
DimerizationForms heterodimers with Mrgprd, modulating β-alanine responses
Signaling pathwayCoupled to Gi/o proteins, influencing cAMP and calcium signaling
Tissue expressionPrimarily sensory neurons and immune cells (inferred from MRGPR family studies)

Research Applications

Recombinant Mrgpre is critical for:

  • Ligand screening: Identifying agonists/antagonists via binding assays.

  • Mechanistic studies: Resolving activation pathways and crosstalk with other receptors (e.g., Mrgprd) .

  • Disease models: Investigating roles in itch, pain, and mast cell-mediated inflammation .

Challenges and Future Directions

  • Structural data: No high-resolution structures of Mrgpre exist, hindering mechanistic insights .

  • Ligand identification: Endogenous ligands for Mrgpre remain unidentified, unlike MRGPRX2 (activated by basic secretagogues) .

  • Species differences: Human MRGPRE lacks direct rodent orthologs, complicating translational studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. This can serve as a reference for your own protocols.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your protein.
Synonyms
Mrgpre; Ebrt3; Mrge; Mas-related G-protein coupled receptor member E; Evolutionary breakpoint transcript 3 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTSLSVHTDSPSTQGEMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLD VACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLTMLRFFCYIVGLSLLAAISTEQCLA TLFPAWYLCRRPRYLTTCVCALIWVLCLLLDLLLSGACTQFFGAPSYHLCDMLWLVVAVL LAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLAVLLFLFCGLPFGIFWLSKNLSW HIPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFREPLRLVLQRALGDEAELGAGREA SQGGLVDMTV
Uniprot No.

Target Background

Function
MrgE is an orphan receptor. It may regulate nociceptor function and/or development, including the sensation or modulation of pain.
Gene References Into Functions
  1. Research suggests that MrgE plays a role in specific pain behavioral responses in mice. PMID: 18197975
Database Links

KEGG: mmu:244238

UniGene: Mm.183561

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.