Recombinant Mouse Mas-related G-protein coupled receptor member F (Mrgprf)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

Mrgprf belongs to the Class A (Rhodopsin) Orphan receptors family. Key structural features include:

FeatureDetails
Gene SymbolMrgprf (Mouse: Chromosome 7 F5; Human: MRGPRF, Chromosome 11q13.3)
Protein Length343 amino acids (mouse)
Transmembrane Domains7 transmembrane helices (TM1–TM7) with intracellular (ICL1–3) and extracellular (ECL1–3) loops
Unique MotifsLacks canonical GPCR motifs (e.g., CWxP, PIF, DRY), but retains a TM4-TM5 disulfide bond

The receptor’s extracellular domains exhibit high variability, enabling diverse ligand interactions, while conserved intracellular domains mediate G-protein signaling .

Production Methods and Applications

Recombinant Mrgprf is produced via heterologous expression systems:

Host SystemAdvantagesApplications
E. coliHigh yield, cost-effective; used for His-tagged proteins Structural studies, ligand binding
Mammalian CellsNative post-translational modifications (e.g., glycosylation) Functional assays, signaling studies
HEK293/Wheat GermFlexible expression for soluble fragments or membrane-bound receptors Agonist/antagonist screening

Common tags include His-tag (for purification) and Flag/DDK (for detection) . Recombinant Mrgprf is critical for studying ligand-receptor interactions, G-protein coupling, and downstream signaling pathways .

Tumor Suppression in Melanoma

Mrgprf inhibits melanoma progression by:

  • Reducing PI3K/Akt signaling: Disrupts p101-p110γ subunit interaction, blocking PIP2→PIP3 conversion .

  • Suppressing metastasis: Overexpression in B16 melanoma cells reduces lung metastases by 50% in vivo .

  • Inducing cell cycle arrest: Forces G0/G1 phase accumulation, slowing proliferation .

Key Agonist: AMG 706 (a multikinase inhibitor) activates Mrgprf, inhibiting tumor growth in xenograft models .

Sensory and Immune Signaling

  • Pain/Itch Modulation: MRGPR family members (e.g., MrgprD) recognize β-alanine and neuropeptides, though Mrgprf’s endogenous ligands remain undefined .

  • Immune Cell Regulation: MRGPRs, including Mrgprf, may modulate mast cell degranulation and neuro-immune crosstalk .

Research Applications and Tools

ToolPurposeExample
AntibodiesDetection in Western blot, IHC, or ELISA Rabbit anti-Mrgprf (WB/ELISA)
Control FragmentsValidate antibody specificity (e.g., ThermoFisher RP-95172) His-tagged recombinant protein
Ligand LibrariesScreen for agonists/antagonists (e.g., AMG 706) High-throughput cell-based assays

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mrgprf; Mrgf; Mas-related G-protein coupled receptor member F; Mas-related gene F protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAGNCSWEAHSTNQNKMCPGMSEARELYSRGFLTIEQIATLPPPAVTNYIFLLLCLCGLV GNGLVLWFFGFSIKRTPFSIYFLHLASADGMYLFSKAVIALLNMGTFLGSFPDYIRRVSR IVGLCTFFTGVSLLPAISIERCVSVIFPTWYWRRRPKRLSAGVCALLWMLSFLVTSIHNY FCMFLGHEAPGTVCRNMDIALGILLFFLFCPLMVLPCLALILHVECRARRRQRSAKLNHV VLAIVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ RLWEPLRVVFQRALRDGAEPGDAASSTPNTVTMEMQCPSGNAS
Uniprot No.

Target Background

Function
Mrgprf is an orphan receptor. It may bind to a neuropeptide and could regulate nociceptor function and/or development, including the sensation or modulation of pain.
Gene References Into Functions
  1. The number of enteric neurons expressing MrgE and MrgF receptors was significantly reduced during intestinal schistosomiasis and ileitis. PMID: 21912971
  2. ORF49 protein promoted the ability of RTA to activate downstream target promoters and enhanced murine gammaherpesvirus 68 replication PMID: 17634244
Database Links

KEGG: mmu:211577

UniGene: Mm.215151

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mrgprf and where is it primarily expressed in mouse tissues?

Mrgprf is a member of the Mas-related G protein-coupled receptor (MRGPR) family. In mice, Mrgprf shows ubiquitous expression across multiple tissues, with notably higher expression levels in skin and lung tissues . This expression pattern is similar to the human ortholog, which is also widely expressed across various tissues including skin . While many Mrgpr family members are predominantly expressed in sensory neurons of the dorsal root ganglia and trigeminal ganglia, Mrgprf's expression outside the nervous system suggests broader physiological roles beyond sensory functions like itch and pain that are typically associated with other Mrgpr family members .

How does mouse Mrgprf compare structurally to other Mrgpr family members?

Mouse Mrgprf belongs to the Mrgpr family, which consists of approximately 40 members grouped into nine distinct subfamilies (A-H and X) . While detailed structural information specifically for Mrgprf is limited in the search results, insights from related Mrgpr members like MrgprD provide valuable comparison points. MrgprD has been characterized through cryo-EM structures of the MrgprD-Gi complex, revealing both ligand-bound and apo states . Based on these findings, we can infer that Mrgprf likely shares the canonical seven-transmembrane domain structure typical of GPCRs, with specific extracellular domains for ligand binding and intracellular domains for G-protein coupling. The extracellular half of the sixth transmembrane helix appears particularly important for activation in MrgprD , which might represent a conserved activation mechanism within the Mrgpr family including Mrgprf.

What are the documented functional domains of Mrgprf relevant for recombinant protein design?

Functional domain analysis of Mrgprf has identified specific regions critical for its protein-protein interactions. Particularly noteworthy is the MrgprF 295-343 fragment, which has been demonstrated to be essential for mediating the interaction with the p110γ subunit of PI3K . This interaction domain is crucial for Mrgprf's tumor suppressive function, as it competes with p101 to form a complex with p110γ, thereby reducing PIP3 generation and downstream signaling activation . When designing recombinant Mrgprf constructs, researchers should prioritize preserving the integrity of this domain to maintain functional interactions. Additionally, for detection purposes in experimental systems, C-terminal Flag-tagged Mrgprf has been successfully employed in multiple studies, suggesting this approach does not significantly interfere with protein function .

How should researchers optimize expression systems for recombinant mouse Mrgprf production?

For optimal expression of functional recombinant mouse Mrgprf, lentiviral expression systems have proven particularly effective in research settings . These systems allow for stable integration and expression in various cell types, including melanoma cell lines like A375 and A875, as well as other mammalian cells. When designing expression constructs, incorporating epitope tags such as Flag-tag at the C-terminus has been validated for detection without compromising functionality . For in vitro studies requiring larger quantities of purified protein, GST-fusion proteins of Mrgprf fragments (particularly the GST-fused MrgprF 274-343 fragment) have been successfully produced and utilized in protein-protein interaction assays . Expression validation should include both mRNA quantification via real-time RT-PCR and protein detection through immunoblotting to confirm proper expression levels and molecular weight .

How can researchers validate Mrgprf's tumor suppressor function in melanoma models?

Validating Mrgprf's tumor suppressor function requires a multi-faceted experimental approach. In vitro validation should include: (1) Overexpression studies in melanoma cell lines using lentiviral systems with C-terminal Flag-tagged Mrgprf, followed by proliferation assays (BrdU incorporation), colony formation assays, and cell cycle analysis by flow cytometry to quantify G0/G1 phase arrest ; (2) Assessment of key cell cycle regulators including p27, CDK2, CDK4, CDK6, and Cyclin D1 proteins by immunoblotting ; (3) Migration assays to evaluate metastatic potential; and (4) Complementary knockdown experiments using specific shRNAs targeting Mrgprf to demonstrate opposite effects.

For in vivo validation, xenograft tumor models using nude mice have proven effective, with subcutaneous injection of 1×10^6 cells (control vs. Mrgprf-overexpressing cells) and subsequent measurement of tumor volume every 4 days . Tumor specimens should be evaluated for proliferation markers (Ki67) and apoptosis markers (cleaved caspase-3) by immunohistochemistry . For metastasis studies, lung metastasis models using B16 mouse melanoma cells with forced expression of mouse Mrgprf have successfully demonstrated reduced metastatic burden compared to control groups .

What methodological approaches reveal Mrgprf's molecular mechanism in PI3K/Akt pathway inhibition?

To elucidate Mrgprf's mechanism in PI3K/Akt pathway inhibition, researchers should implement the following approaches:

  • Co-immunoprecipitation (co-IP) assays to demonstrate direct interaction between Mrgprf and p110γ, using both overexpression systems and endogenous proteins

  • Domain mapping using a series of Mrgprf and p110γ mutants to identify the specific interaction interfaces (MrgprF 295-343 and p110γ 1-216 fragments have been identified as critical)

  • GST-pull down assays with purified proteins to confirm direct physical interaction

  • Competition assays to demonstrate that Mrgprf competes with p101 for binding to p110γ, thereby disrupting the p101-p110γ complex formation

  • PIP3 generation assays to measure the functional consequence of this competition, showing reduced PIP3 levels upon Mrgprf overexpression and increased PIP3 upon Mrgprf knockdown

  • Western blot analysis of phosphorylated Akt levels as a downstream readout of PI3K activity

  • Rescue experiments using Akt-specific agonists like SC79 to demonstrate pathway specificity

What approaches can identify potential agonists for recombinant Mrgprf in drug discovery?

For identifying potential Mrgprf agonists, researchers should employ a systematic screening approach combining computational and experimental methods:

  • Initial screening: Screen compound libraries using cell-based assays with Mrgprf-overexpressing cell lines. For example, AMG 706, previously documented as an inhibitor for endothelial cell proliferation, was identified as a potential agonist for MrgprF through such screening approaches .

  • Functional validation: Validated candidates should be tested in assays measuring:

    • Effects on tumor cell proliferation in Mrgprf-expressing versus control cells

    • Impact on xenograft tumor growth in vivo

    • Ability to reproduce molecular effects of Mrgprf overexpression, such as reduced PI3K/Akt pathway activation

  • Specificity testing: Conduct comparative assays across related Mrgpr family members to determine selectivity profiles, similar to approaches used for distinguishing chloroquine responses among different Mrgpr subtypes .

  • Structure-activity relationship studies: Based on identified hits, develop analogs with improved potency, selectivity, and pharmacokinetic properties.

How can researchers assess changes in Mrgprf expression across melanoma progression stages?

To accurately assess Mrgprf expression changes across melanoma progression, researchers should implement a comprehensive approach:

  • Transcriptomic analysis: Analyze RNA-seq or microarray datasets comparing Mrgprf expression in common melanocytic nevi (CMN), primary melanoma, and advanced-stage melanoma samples. Published studies have shown that Mrgprf is markedly decreased in advanced stage melanoma compared to CMN and primary melanoma .

  • Protein expression validation: Perform immunohistochemistry on tissue microarrays containing samples from different melanoma progression stages, quantifying Mrgprf protein levels.

  • Epigenetic analysis: Assess promoter methylation status of Mrgprf, as hypermethylation has been identified as a mechanism for its downregulation in melanoma tissues and cell lines .

  • Correlation with genetic alterations: Analyze the relationship between Mrgprf expression and common melanoma mutations. Previous research has shown positive correlation between low Mrgprf expression and RAS/BRAF mutations in melanoma cell lines .

  • Patient outcome correlation: Evaluate association between Mrgprf expression levels and clinical outcomes, as high Mrgprf expression has been linked to improved clinical outcomes in cutaneous melanoma patients .

What experimental design best determines if Mrgprf affects response to conventional melanoma therapies?

To determine whether Mrgprf affects response to conventional melanoma therapies, researchers should design experiments that systematically evaluate treatment sensitivity in the context of varying Mrgprf expression:

Notably, preliminary research has shown that while baseline apoptosis was not affected by Mrgprf overexpression, Mrgprf-overexpressing cells exhibited significantly higher apoptosis rates when treated with cisplatin or Vemurafenib compared to control cells , suggesting a potential role for Mrgprf in modulating treatment response.

How should researchers evaluate Mrgprf expression and regulation in clinical samples?

Comprehensive evaluation of Mrgprf expression and regulation in clinical samples requires a multi-modal approach:

  • mRNA quantification: Implement RT-qPCR for precise quantification of Mrgprf transcript levels, normalizing to multiple reference genes for reliability. For broader analysis, RNA-sequencing provides comprehensive transcriptomic profiling.

  • Protein detection: Utilize immunohistochemistry (IHC) on tissue sections with validated anti-Mrgprf antibodies, employing standardized scoring systems to quantify expression patterns and subcellular localization. Western blotting of tissue lysates provides complementary quantitative assessment.

  • Epigenetic regulation: Assess DNA methylation status of the Mrgprf promoter region using bisulfite sequencing or methylation-specific PCR, as hypermethylation has been identified as a key mechanism for Mrgprf downregulation in melanoma .

  • Mutation profiling: Perform targeted sequencing of the Mrgprf gene to identify potential mutations or polymorphisms that might affect expression or function. Previous studies have utilized the cBioPortal web-source and GSCALite database to analyze Mrgprf mutation profiles in cancer patients .

  • Correlation with clinical parameters: Systematically analyze associations between Mrgprf expression and clinical variables including tumor stage, histological subtype, mutation status (particularly RAS and BRAF mutations), and patient outcomes .

  • Single-cell analysis: For heterogeneous samples, employ single-cell RNA sequencing to delineate Mrgprf expression across different cell populations within the tumor microenvironment.

What are the recommended controls for Mrgprf knockdown and overexpression experiments?

For rigorous Mrgprf functional studies, implementing appropriate controls is essential:

For Mrgprf knockdown experiments:

  • Non-targeting shRNA control: Use scrambled or non-targeting shRNA sequences with similar length and GC content to control for non-specific effects of the shRNA delivery system.

  • Multiple targeting sequences: Employ at least two independent shRNA sequences targeting different regions of Mrgprf to confirm phenotype specificity and rule out off-target effects .

  • Rescue experiments: Reintroduce shRNA-resistant Mrgprf (containing silent mutations in the targeted sequence) to demonstrate specificity of the observed phenotype.

  • Validation of knockdown efficiency: Quantify knockdown at both mRNA (RT-qPCR) and protein levels (Western blot) to ensure consistent suppression throughout the experimental timeframe.

For Mrgprf overexpression experiments:

  • Empty vector control: Use the same viral backbone lacking the Mrgprf sequence as in studies utilizing lentiviral expression systems .

  • Expression level monitoring: Validate overexpression by both real-time RT-PCR and immunoblot assays to ensure consistent expression levels .

  • Inducible expression systems: Consider tetracycline-inducible systems to control expression timing and levels, providing more physiologically relevant models.

  • Functional validation: Confirm biological activity of the overexpressed protein through known downstream effects, such as reduced PI3K/Akt pathway activation.

  • Wild-type vs. mutant comparisons: Include non-functional Mrgprf mutants (e.g., mutations in the critical 295-343 domain) to demonstrate domain-specific functions .

What models best examine the relationship between Mrgprf and metastatic potential in melanoma?

To rigorously examine Mrgprf's impact on metastatic potential in melanoma, researchers should implement complementary in vitro and in vivo models:

In vitro metastasis models:

  • Migration assays: Perform wound healing (scratch) assays and transwell migration assays to assess basic cell motility. Previous studies have demonstrated that Mrgprf overexpression significantly impairs wound healing capacity and reduces the number of migrated cells in transwell assays .

  • Invasion assays: Use Matrigel-coated transwell chambers to evaluate invasive capacity through extracellular matrix.

  • 3D spheroid invasion models: Embed melanoma spheroids in collagen matrices to assess invasive growth in a more physiologically relevant 3D environment.

  • EMT marker analysis: Examine epithelial-mesenchymal transition markers including E-cadherin, N-cadherin, vimentin, and EMT-associated transcription factors by immunoblotting and immunofluorescence .

In vivo metastasis models:

  • Lung metastasis model: Utilize tail vein injection of B16 mouse melanoma cells with forced expression of mouse Mrgprf versus control cells. This model has successfully demonstrated that Mrgprf overexpression significantly inhibits the formation of lung metastases .

  • Spontaneous metastasis model: Implant melanoma cells subcutaneously and monitor both primary tumor growth and spontaneous metastasis to distant organs, providing a more complete model of the metastatic cascade.

  • Intracardiac injection model: For studying bone metastasis, which is clinically relevant in melanoma.

  • Molecular imaging: Incorporate bioluminescent or fluorescent reporter systems to enable real-time tracking of metastatic spread.

Additional considerations:

  • Patient-derived xenografts: Use patient-derived melanoma samples with varying levels of endogenous Mrgprf expression for greater clinical relevance.

  • Immunocompetent models: Consider syngeneic mouse models that maintain an intact immune system, particularly important given potential interactions between metastasis and immune surveillance.

  • Mechanistic validation: Confirm involvement of PI3K/Akt pathway inhibition in the anti-metastatic effects through pharmacological intervention (e.g., PI3K inhibitors, Akt agonist SC79) .

How does Mrgprf interact with the PI3K signaling complex to suppress tumor progression?

Mrgprf employs a distinct mechanism to suppress PI3K signaling and consequently tumor progression:

  • Direct protein interaction: Mrgprf directly binds to the p110γ catalytic subunit of PI3K through a specific interaction between the MrgprF 295-343 fragment and the p110γ 1-216 region . This interaction has been validated through co-immunoprecipitation and GST-pull down assays .

  • Competitive binding mechanism: Mrgprf competitively inhibits the formation of the active PI3K complex by disrupting the interaction between p110γ and its regulatory subunit p101 . Normally, p101-p110γ complex formation is a critical step for the conversion of phosphatidylinositol-(3,4)-P2 (PIP2) to phosphatidylinositol-(3,4,5)-P3 (PIP3) .

  • Reduced PIP3 generation: By preventing proper p101-p110γ complex formation, Mrgprf reduces the generation of PIP3, a critical second messenger that activates downstream signaling . This has been experimentally confirmed, as Mrgprf overexpression reduces PIP3 levels while Mrgprf knockdown increases PIP3 generation .

  • Suppressed Akt activation: The reduction in PIP3 levels leads to decreased activation of Akt, a key downstream effector of PI3K signaling that promotes cell survival, proliferation, and migration .

  • Reversibility by Akt agonists: The inhibitory effect of Mrgprf on tumor progression can be reversed by the Akt-specific agonist SC79, confirming that Mrgprf's tumor suppressor function operates primarily through the PI3K/Akt axis .

  • Cell cycle regulation: The suppression of PI3K/Akt signaling by Mrgprf leads to increased expression of the cell cycle inhibitor p27 and decreased levels of positive cell cycle regulators including CDK2, CDK4, CDK6, and Cyclin D1, resulting in G0/G1 phase arrest .

This unique mechanism distinguishes Mrgprf from many conventional tumor suppressors and offers potential for targeted therapeutic approaches in melanoma and potentially other cancers where PI3K/Akt signaling plays a critical role.

What methodologies can detect Mrgprf activation in real-time cellular assays?

Detecting Mrgprf activation in real-time cellular assays requires specialized techniques targeting different aspects of GPCR signaling:

How does Mrgprf expression correlate with mutations in melanoma-associated genes like BRAF and RAS?

Analysis of Mrgprf expression in relation to common melanoma-associated mutations reveals significant correlations with important clinical implications:

  • Inverse correlation with oncogenic mutations: MrgprF expression shows a significant negative correlation with RAS and BRAF mutations in melanoma datasets . Specifically, analysis of the Cancer Cell Line Encyclopedia (CCLE) melanoma dataset revealed that low MrgprF expression positively correlates with the presence of RAS and BRAF mutations .

  • Stage-dependent expression: MrgprF expression is markedly decreased in advanced stage melanoma compared to common melanocytic nevi (CMN) and primary melanoma, suggesting progressive loss of this tumor suppressor with disease advancement . This pattern aligns with the increasing prevalence of activating BRAF and RAS mutations in later-stage disease.

  • Mechanism of downregulation: The inverse relationship between Mrgprf expression and oncogenic mutations may be explained by epigenetic silencing. Hypermethylation of the Mrgprf promoter region has been identified as a mechanism for its downregulation in melanoma tissues and cell lines , and this epigenetic modification may be more prevalent in tumors carrying BRAF or RAS mutations.

  • Functional antagonism: Mechanistically, the negative correlation makes biological sense as Mrgprf inhibits PI3K/Akt signaling , which is frequently activated downstream of RAS and BRAF mutations. The loss of Mrgprf may therefore represent a complementary event that enhances oncogenic signaling from these mutations.

  • Therapeutic implications: The inverse relationship between Mrgprf expression and BRAF mutations suggests potential value in combining BRAF inhibitors with approaches to restore or mimic Mrgprf function. Indeed, experimental evidence indicates that Mrgprf overexpression enhances cellular sensitivity to the BRAF inhibitor Vemurafenib , supporting this therapeutic strategy.

This correlation pattern suggests that Mrgprf loss may be a cooperative event in BRAF/RAS-driven melanoma progression and highlights the potential for Mrgprf-targeted approaches as complementary strategies to existing targeted therapies.

What are the methodological challenges in differentiating Mrgprf effects from other Mrgpr family members?

Distinguishing Mrgprf-specific effects from those mediated by other Mrgpr family members presents several methodological challenges that researchers must address:

  • Sequence and structural homology: The Mrgpr family comprises approximately 40 members with varying degrees of sequence similarity . This homology can lead to cross-reactivity of antibodies, non-specific binding of ligands, and potential functional redundancy.

  • Expression overlap: While many Mrgpr family members show restricted expression in sensory neurons, several may be co-expressed in the same tissues or cell types . This complicates the interpretation of phenotypes observed in knockout or overexpression models.

  • Limited specific tools: There is a relative scarcity of highly selective antibodies, ligands, and inhibitors for individual Mrgpr family members, making precise manipulation and detection challenging.

  • Methodological solutions:

    • CRISPR/Cas9 gene editing: Generate precise knockouts of Mrgprf without affecting other family members.

    • siRNA/shRNA with validated specificity: Design and rigorously validate knockdown constructs to ensure they target only Mrgprf and not related family members .

    • Rescued phenotypes: Confirm specificity by rescuing knockdown phenotypes with expression constructs containing silent mutations resistant to the siRNA/shRNA .

    • Multiple independent approaches: Use complementary methods to manipulate Mrgprf levels and function to validate findings.

    • Heterologous expression systems: Express Mrgprf in cell lines lacking endogenous Mrgpr family members to isolate specific effects.

    • Single-cell analysis: Employ single-cell transcriptomics to precisely define expression patterns of different Mrgpr family members across cell types.

    • Comparative screening: Test ligands and compounds across multiple Mrgpr family members to establish selectivity profiles, similar to approaches used for chloroquine responses among Mrgpr subtypes .

  • Functional readouts: Employ readouts specific to Mrgprf's known functions, such as PI3K complex formation and PIP3 generation , which may differ from the typical pain and itch signaling associated with other Mrgpr family members predominantly expressed in sensory neurons .

How might recombinant Mrgprf or its agonists be developed as therapeutic agents?

Development of Mrgprf-based therapeutics presents both opportunities and challenges, requiring a strategic approach:

  • Therapeutic modalities:

    • Small molecule agonists: AMG 706 has been identified as a potential Mrgprf agonist with demonstrated anti-tumor effects both in vitro and in vivo . This provides a starting point for medicinal chemistry optimization to develop more potent and selective compounds.

    • Recombinant protein therapy: Delivering the functional domain of Mrgprf (particularly the 295-343 fragment) that competes with p101 for binding to p110γ could potentially inhibit PI3K signaling . This approach would require development of cell-penetrating peptides or other delivery systems.

    • Gene therapy approaches: Viral vector-mediated delivery of Mrgprf could restore expression in tumors where it has been epigenetically silenced .

    • Epigenetic modifiers: Since Mrgprf downregulation in melanoma occurs through promoter hypermethylation , DNA methyltransferase inhibitors could potentially restore endogenous expression.

  • Target patient populations:

    • Melanoma patients with low Mrgprf expression and activated PI3K/Akt signaling

    • Patients with BRAF or RAS mutations, where Mrgprf expression is typically lower

    • Potentially applicable to other cancer types where Mrgprf is downregulated (CCLE and GEPIA datasets indicate downregulation in multiple cancer types)

  • Combination therapy approaches:

    • Combined with BRAF inhibitors for BRAF-mutant melanoma, as Mrgprf overexpression enhances sensitivity to Vemurafenib

    • Combined with conventional chemotherapeutics like cisplatin, as Mrgprf overexpression increases apoptotic response to these agents

  • Development challenges:

    • Ensuring selective activation of Mrgprf without affecting related Mrgpr family members

    • Developing systemic delivery methods that effectively target tumor cells

    • Overcoming potential compensatory mechanisms that might arise in response to PI3K/Akt inhibition

  • Biomarker development:

    • Implement Mrgprf expression testing as a potential biomarker for patient selection

    • Develop assays to monitor pathway inhibition (e.g., PIP3 levels, Akt phosphorylation) as pharmacodynamic markers

The therapeutic potential of targeting Mrgprf is particularly promising given its documented tumor suppressor role and the availability of a potential agonist (AMG 706) with demonstrated anti-tumor effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.