Recombinant Mouse Mas-related G-protein coupled receptor member G (Mrgprg)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Mas-related G-protein Coupled Receptor Member G (Mrgprg)

Recombinant Mouse Mas-related G-protein coupled receptor member G (Mrgprg) is a synthetic version of the native MRGPRG protein, expressed in E. coli for research purposes. Belonging to the MRGPR family of class A GPCRs, it shares structural and functional characteristics with other MRGPRs, which are primarily involved in immune regulation and sensory signaling . Unlike some MRGPRs with identified ligands (e.g., MRGPRX2 binds β-defensins), MRGPRG remains an orphan receptor with no confirmed physiological ligands .

Recombinant Production and Functional Insights

The recombinant Mrgprg is produced for structural and functional studies. Key production details include:

ParameterDetailSource
Host OrganismE. coli
Expression RegionFull-length (1–289 amino acids)
Purity>85% (SDS-PAGE verified)
Storage-20°C (lyophilized) or -80°C (long-term)

Functional Significance:

  • Orphan Status: No endogenous ligands identified, limiting direct functional studies .

  • Potential Roles: MRGPRs broadly regulate immune responses (e.g., mast cell activation, neutrophil recruitment) , but Mrgprg’s specific role remains uncharacterized.

  • Structural Plasticity: MRGPRs exhibit unique extracellular loops and TM kinks critical for ligand recognition , though Mrgprg’s binding pocket properties are unexplored.

Research Applications and Challenges

Mrgprg serves as a tool for studying GPCR biology, though its utility is constrained by limited data:

ApplicationDetailsSource
Structural BiologyElucidating MRGPR family-specific TM kinks and extracellular loop conformations
Ligand DiscoveryScreening for orphan ligands (e.g., peptides, small molecules)
Immune ModulationHypothetical role in bacterial defense or inflammatory responses (based on MRGPRX2 analogs)

Key Challenges:

  • Lack of Functional Data: No published studies directly linking Mrgprg to signaling pathways (e.g., G protein coupling) .

  • Species-Specific Differences: Human MRGPRs show limited homology to murine counterparts, complicating extrapolation .

Current Status and Future Directions

Mrgprg remains understudied, with recombinant versions primarily used for preliminary biochemical analyses. Critical gaps include:

  • Ligand Identification: High-throughput screening is needed to uncover potential agonists/antagonists.

  • Tissue Expression: Limited data on endogenous expression sites in mice.

  • Therapeutic Potential: MRGPRs are targets for drug-induced pseudo-allergic reactions (e.g., MRGPRX2 in vancomycin responses) , but Mrgprg’s role in similar pathways is unknown.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Mrgprg; Ebrt2; Gm1098; Mrgg; Mas-related G-protein coupled receptor member G; Evolutionary breakpoint transcript 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MFSIFNIWGTFNKVLFFLSLTVSLAGLVGNALLLWHLGLHIKKGPFNTYLLHLAAADFLF LSCQVGFSIATIVSGHEDTLYFPVTFLWFAVGLWLLAAFSVDCCLAYMFPSFCSPNRRPR FTSVVLCLVIWALTMPAVLLPANACGLLKNGMSLLVCLKYHWTSVTWLAVLSGMACGASK FLLIFGNCCSSQPPPKFCKLAQCSGILLFFCRLPLVVYWCLRPVLKFLLPFFFPLATLLA CIDSSAKPLLYYMKGRQLRKDPLQVALNRALGEESQSGLGGLSLPMHQV
Uniprot No.

Target Background

Function
Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links
Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse Mrgprg and how is it related to the broader MRGPR family?

Mouse Mrgprg (Mas-related G protein-coupled receptor member G) belongs to the larger MRGPR family of G protein-coupled receptors. MRGPRs play crucial roles in sensing noxious stimuli and represent potential therapeutic targets for treating itch and pain . The MRGPR family is subdivided into nine subfamilies (A-H and X), with Mrgprg being part of subfamily G, which is conserved across mammalian species . In contrast, subfamilies A, B, C, and H exist only in rodents, while the X subfamily is found exclusively in primates .

MRGPRs recognize diverse agonists and exhibit complex downstream signaling profiles. While some MRGPR subfamilies have undergone significant expansion in mice (≈22 MrgA and ≈14 MrgC genes), others like Mrgprg have remained more conserved across species . This evolutionary pattern suggests that Mrgprg likely serves fundamental physiological functions that are preserved across mammalian lineages.

What is the tissue expression pattern of Mrgprg in mice?

The tissue distribution of Mrgprg appears to be relatively restricted compared to some other MRGPR family members. Based on comparative studies with dog MRGPRG, which shows limited tissue distribution primarily in skin regions (eyelid, abdomen, and cheek), mouse Mrgprg likely exhibits a similar restricted expression pattern .

In contrast, other MRGPRs such as MRGPRD and MRGPRF show much broader expression, being found in almost all tissues examined . While many Mrgprs (e.g., MrgprA, MrgprB4, MrgprB5, MrgprC11, and MrgprD) are expressed specifically in small-diameter nociceptive sensory neurons in the dorsal root ganglia (DRG), MRGPRs from subfamilies D through G (including Mrgprg) can also be expressed in other tissues such as bladder, testis, uterus, arteries, intestines, and adrenal glands . This suggests that Mrgprg may have functions beyond sensory neuron signaling.

What structural features distinguish Mrgprg from conventional GPCRs?

MRGPRs, including Mrgprg, possess several unique structural features that distinguish them from other Family A GPCRs:

  • Disulfide bond arrangement: MRGPRs have a unique TM4-TM5 disulfide bond instead of the canonical TM3-ECL2 disulfide bond found in most Family A GPCRs .

  • Extracellular loop structure: Without the TM3-ECL2 disulfide bond, the ECL2 of MRGPRs flips away from the center rather than covering the agonist binding pocket. This structural difference results in relatively low binding affinities for many endogenous MRGPR agonists .

  • Absent canonical motifs: MRGPRs lack most of the canonical motifs important for receptor activation in conventional GPCRs, including the CWxP motif, PIF motif, and the semi-conserved DRY motif .

  • Sodium binding site: MRGPRs lack a key TM3 residue (S3.39) required for sodium binding, which may explain their high basal activity .

These structural differences contribute to the unique pharmacological properties of Mrgprg and may present both challenges and opportunities for drug development targeting this receptor.

How can recombinant Mrgprg protein be generated and validated for experimental use?

Generating functional recombinant Mrgprg involves several steps:

  • Expression system selection: Based on approaches used for other MRGPRs, HEK293 cells are commonly employed to express recombinant Mrgprg . This system allows for proper post-translational modifications and membrane trafficking of GPCRs.

  • Vector construction: The mouse Mrgprg gene is cloned into an appropriate expression vector with tags (His, Fc, or Avi tags) to facilitate purification and detection .

  • Protein production: After transfection and expression, the recombinant protein can be purified using affinity chromatography based on the incorporated tags .

  • Validation methods:

    • Functional assays such as intracellular Ca²⁺ mobilization to confirm receptor activity

    • Western blot to verify protein expression and molecular weight

    • Immunocytochemistry to confirm membrane localization

    • Ligand binding assays to verify pharmacological properties

  • Preparation formats: For some applications, coupling to magnetic beads may be useful, providing "ready-to-use, pre-coupled magnetic beads in uniform particle size and narrow size distribution with large surface area, conducive to convenient and fast capture of target molecules with high specificity" .

Validation should include both positive controls (known MRGPR agonists) and negative controls (untransfected cells) to ensure specificity of the recombinant receptor's responses.

What signaling pathways are activated downstream of Mrgprg?

While the specific signaling profile of Mrgprg has not been fully characterized, insights from other MRGPR family members suggest:

  • G protein coupling: MRGPRs typically couple to multiple G protein subfamilies, with particular emphasis on Gi and Gq pathways . Some MRGPRs like MRGPRX2 can activate all four major G protein subtypes (Gs, Gi, Gq/11, and G12/13), indicating promiscuous signaling capabilities .

  • Synergistic signaling: In MRGPRX2, Gi and Gq pathways appear to act synergistically, with both required for maximum mast cell degranulation . The free Gβγ subunit released by activated Gi protein can recruit Phospholipase C-β to the cell membrane, accelerating Gq signaling.

  • Downstream effects: Based on studies of MrgprB2 (mouse homolog of human MRGPRX2), activation leads to calcium mobilization and subsequent mast cell degranulation .

  • Interaction with other receptors: P2X4 receptor stimulation by extracellular ATP can enhance Mrgpr-mediated responses, as demonstrated with MrgprB2, suggesting complex receptor crosstalk .

Understanding these pathways is critical for designing targeted interventions and interpreting experimental results in MRGPR research.

How do species differences in Mrgprg affect experimental design and data interpretation?

Species differences present significant challenges in MRGPR research:

Species ComparisonKey DifferencesExperimental Implications
Mouse vs. HumanHigh sequence diversity; different subfamily organizationDifficult to translate findings directly to humans
Mouse vs. Rat/GerbilMice have expanded MRGPR gene families (≈22 MrgA, ≈14 MrgC genes) compared to single genes in rat/gerbilFindings in mice may not reflect general rodent physiology
Within-species variantsNatural polymorphisms can dramatically affect ligand responsesNeed for genetic characterization of experimental animals

These differences necessitate several experimental considerations:

Understanding these species differences is essential for designing experiments that yield translatable results and for correctly interpreting existing literature on Mrgprg function.

What approaches can distinguish Mrgprg-specific effects from general MRGPR family effects?

Several methodological approaches can help isolate Mrgprg-specific effects:

  • Genetic manipulation techniques:

    • CRISPR/Cas9-mediated knockout of Mrgprg specifically

    • Conditional knockout models to control temporal and spatial expression

    • Knockin models expressing tagged versions for tracing studies

  • Pharmacological approaches:

    • Identification of selective Mrgprg ligands through screening protocols

    • Comparative pharmacology across multiple MRGPR subtypes to establish selectivity profiles

    • Use of antagonists with defined selectivity profiles

  • Heterologous expression systems:

    • Expression of single MRGPR subtypes in cell lines lacking endogenous MRGPRs

    • Creation of stable cell lines with controlled receptor densities

    • Side-by-side comparison of responses in cells expressing different MRGPRs

  • Biophysical techniques:

    • BRET-based assays to monitor specific G protein coupling profiles

    • Single-cell calcium imaging to identify cell-specific responses

    • Electrophysiological recordings to characterize channel modulation

These approaches, especially when used in combination, can help delineate Mrgprg-specific functions from those shared across the MRGPR family.

How does Mrgprg contribute to mast cell function and inflammatory responses?

While specific Mrgprg contributions to mast cell function are not fully characterized, insights from related MRGPRs provide a framework for understanding potential mechanisms:

  • Mast cell activation: MRGPRs expressed in mast cells (e.g., MRGPRX2 in humans, MrgprB2 in mice) respond to various stimuli including basic secretagogues, neuropeptides, and certain drugs, triggering degranulation .

  • Non-IgE pathways: Mrgpr-mediated mast cell activation represents a non-IgE, non-FcεRI pathway for triggering inflammatory responses, often termed "pseudoallergic reactions" .

  • Degranulation characteristics: Compared to IgE-mediated activation, MrgprB2 stimulation triggers more rapid degranulation of smaller granules, with different temporal patterns of calcium signaling .

  • Pseudoallergic reactions: MRGPRs like MRGPRX2/MrgprB2 mediate reactions to various therapeutic drugs including fluoroquinolones, neuromuscular blocking agents, and vancomycin, explaining certain drug hypersensitivity reactions that occur without prior exposure .

These findings suggest Mrgprg might similarly contribute to non-IgE-mediated inflammatory pathways, potentially representing targets for intervening in pseudoallergic reactions.

What are the key methodological considerations for studying Mrgprg pharmacology?

Researchers investigating Mrgprg pharmacology should consider:

  • Cellular model selection:

    • Different cell preparations show varying responsiveness to Mrgpr agonists

    • Bone marrow-derived mast cells (BMMCs) present with immature phenotypes and reduced responses to MrgprB2 agonists

    • Peritoneal mast cells (PMCs) generally demonstrate robust responses to Mrgpr stimulation

  • Assay selection and optimization:

    • Intracellular Ca²⁺ mobilization assays are standard for functional evaluation

    • Degranulation assays (β-hexosaminidase release) quantify mast cell activation

    • BRET-based G protein dissociation assays assess coupling to specific G protein subtypes

  • Agonist classification:

    • G protein-biased agonists (e.g., LL-37, icatibant) activate G proteins but resist desensitization/internalization

    • Balanced agonists (e.g., compound 48/80, substance P) activate G proteins and promote receptor desensitization/internalization

    • Different agonist classes may reveal distinct aspects of receptor function

  • Receptor regulation considerations:

    • GRK2 differentially regulates responses to different classes of Mrgpr agonists

    • Receptor phosphorylation, internalization, and recycling dynamics affect signaling temporal patterns

    • Basal activity levels of receptors influence experimental outcomes

  • Experimental controls:

    • Receptor expression levels should be verified and normalized across experiments

    • Vehicle controls should account for potential solvent effects on mast cells

    • Positive controls (e.g., known MRGPR agonists) should be included to validate assay functionality

These methodological considerations are essential for generating reproducible and physiologically relevant data on Mrgprg pharmacology.

How have Mrgprg polymorphisms been characterized and what are their functional implications?

While Mrgprg-specific polymorphism characterization is limited in the literature, studies of other MRGPRs provide a framework for understanding potential implications:

For Mrgprg research, these findings underscore the importance of genetic characterization and suggest that polymorphism analysis should be incorporated into experimental designs, particularly when translating findings across species or to human applications.

What are the evolutionary patterns of Mrgprg compared to other MRGPR family members?

Evolutionary analysis of the MRGPR family reveals distinct patterns that differentiate Mrgprg from other family members:

  • Conservation vs. expansion: While mouse MrgprA and MrgprC subfamilies have undergone dramatic expansion (≈22 MrgA and ≈14 MrgC genes), Mrgprg has remained more evolutionarily conserved across species. Rats and gerbils possess just a single MrgA and MrgC gene compared to the numerous mouse variants .

  • Evolutionary mechanisms: The localized expansion of mouse MrgprA and MrgprC genes appears driven by:

    • High frequency of L1 retrotransposons (>40% L1 sequence) in the gene clusters

    • Unequal crossover events facilitated by these retrotransposons

    • Head-to-tail gene arrangement supporting an unequal crossover mechanism

  • Selection pressures: Sequence analysis indicates most intact MrgprA coding sequences are under neutral or weak negative selection pressure (Ka/Ks ≤ 1), suggesting the expansion was not driven by positive selection for diversification of receptor coding sequences .

  • Functional implications: The relative conservation of Mrgprg across species compared to the expanded MrgprA and MrgprC subfamilies suggests it likely serves fundamental physiological functions that are under stronger evolutionary constraints.

  • Cross-species comparisons:

SpeciesMrgprAMrgprCMrgprg
Mouse~22 genes~14 genesSingle gene
RatSingle geneSingle geneSingle gene
GerbilSingle geneSingle geneSingle gene
HumanNone (MRGPRX instead)None (MRGPRX instead)Single gene (MRGPRG)

This evolutionary pattern provides important context for interpreting research across species and suggests that Mrgprg may serve more fundamental and conserved roles than the rapidly evolving MrgprA and MrgprC subfamilies.

What approaches are most effective for studying Mrgprg gene expression regulation?

Investigating Mrgprg expression regulation requires specialized techniques to address its restricted expression pattern and regulatory mechanisms:

  • Transcriptional regulation analysis:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

    • Promoter reporter assays to define regulatory elements

    • ATAC-seq to map chromatin accessibility in Mrgprg-expressing tissues

    • Single-cell RNA sequencing to identify co-expression patterns with regulatory factors

  • Epigenetic regulation assessment:

    • Bisulfite sequencing to analyze DNA methylation patterns at the Mrgprg locus

    • ChIP for histone modifications to characterize chromatin state

    • Studies of environmental factors affecting methylation, as Mrgprg methylation is influenced by various environmental exposures :

      • Bisphenol A decreases promoter methylation but increases gene methylation

      • Aflatoxin B1 increases promoter methylation

      • Benzo[a]pyrene affects promoter methylation and decreases exon methylation

  • Environmental influence investigation:

    • Chemical exposures show diverse effects on Mrgprg expression :

      • Increased expression: cadmium, perfluorooctanoic acid, paracetamol

      • Decreased expression: carbon nanotubes, propanal, sodium arsenite

  • Genetic tools:

    • Cre-driver lines under Mrgprg promoter control for lineage tracing

    • CRISPR-based epigenome editing to manipulate locus-specific regulation

    • BAC transgenic approaches for studying larger regulatory domains

  • Tissue-specific considerations:

    • In situ hybridization to define spatial expression patterns

    • Laser-capture microdissection combined with qPCR for tissue-specific expression analysis

    • Co-expression analysis with cell-type specific markers

These approaches can help define the tissue-specific and developmentally regulated expression patterns of Mrgprg, providing insights into its physiological roles and potential involvement in disease processes.

How does Mrgprg contribute to pain and itch sensory pathways?

While the specific contribution of Mrgprg to pain and itch pathways is not fully characterized in the literature, studies of related MRGPRs provide insights into potential roles:

  • Sensory neuron expression: Many MRGPRs are expressed in small-diameter somatosensory neurons of the dorsal root ganglion, positioning them as potential modulators of sensory signaling .

  • Pain modulation: Some MRGPRs have been shown to inhibit pathological pain in mice. For example, MrgprC11 activation has analgesic effects in inflammatory and neuropathic pain models .

  • Itch signaling:

    • MrgprA3 mediates chloroquine-induced non-histaminergic itch

    • MrgprB2 activation in mast cells evokes non-histaminergic itch independently of the IgE-FcεRI-histamine axis

    • Mast cell activation by MrgprB2 agonists triggers release of pruritogenic mediators

  • Neuro-immune interactions: MRGPRs serve as interface molecules between the immune and nervous systems, with mast cell-expressed MRGPRs responding to neuropeptides and subsequently modulating neuronal activity .

Based on these patterns, Mrgprg likely contributes to specific aspects of somatosensation, potentially mediating distinct sensory modalities or modulating established pain/itch pathways through interactions with other signaling systems.

What is the relationship between Mrgprg and inflammatory disorders?

While direct evidence linking Mrgprg specifically to inflammatory disorders is limited in the current literature, studies of related MRGPRs suggest potential roles:

  • Pseudoallergic reactions: MRGPRs mediate non-IgE-dependent, "pseudoallergic" reactions to various drugs. For example, MrgprB2/MRGPRX2 recognizes cationic drugs such as fluoroquinolones, neuromuscular blocking agents, and vancomycin, triggering mast cell degranulation without prior sensitization .

  • Skin inflammation: MrgprB2-mediated mast cell activation has been implicated in various skin inflammatory conditions, including:

    • Allergic contact dermatitis

    • Irritant contact dermatitis

    • Rosacea

    • Atopic dermatitis

    • Skin infection

  • Drug hypersensitivity: MRGPRs contribute to adverse drug reactions that make disease treatment difficult, including redneck syndrome from vancomycin .

  • Translational relevance: MrgprB2 antagonists are being explored as therapeutic agents for treating various inflammatory skin diseases .

Given the involvement of other MRGPR family members in these inflammatory processes, Mrgprg may similarly contribute to specific inflammatory contexts, particularly in tissues where it shows highest expression.

How can Mrgprg be targeted therapeutically, and what are the challenges?

Developing therapeutic approaches targeting Mrgprg presents both opportunities and challenges:

  • Target validation challenges:

    • Limited knowledge of Mrgprg's physiological roles compared to other MRGPRs

    • Restricted tissue expression requiring specialized delivery approaches

    • Potential for compensatory mechanisms within the MRGPR family

  • Drug discovery approaches:

    • Structure-based drug design using recent structural advances in MRGPRs

    • High-throughput screening for selective agonists/antagonists

    • Allosteric modulator development to fine-tune rather than fully activate/inhibit signaling

    • Biased ligand discovery to selectively engage beneficial signaling pathways

  • Therapeutic applications based on related MRGPRs:

    • MRGPR antagonists for treating pseudoallergic reactions

    • Modulators of mast cell activation for inflammatory skin conditions

    • Pain and itch pathway interventions

    • Novel approaches for drug hypersensitivity prevention

  • Pharmacological considerations:

    • MRGPRs recognize diverse ligands ranging from small molecules to peptides

    • MRGPRs have distinct extracellular ligand binding pockets with diverse residue composition, pocket size, and charge distribution

    • High receptor basal activity may affect therapeutic window and efficacy

  • Translational challenges:

    • Species differences in receptor pharmacology

    • Polymorphisms affecting drug responses

    • Need for humanized models to validate therapeutic approaches

Despite these challenges, the restricted expression pattern of Mrgprg might offer advantages in terms of reduced off-target effects, making it an attractive therapeutic target if its role in specific pathologies can be clearly established.

What are the optimal protocols for investigating Mrgprg activation in cellular systems?

Based on approaches used for related MRGPRs, optimal protocols for Mrgprg activation studies should include:

  • Cell model selection and preparation:

    • For heterologous expression: HEK293 cells transiently transfected with Mrgprg expression vectors

    • For endogenous expression: Peritoneal mast cells (PMCs) rather than bone marrow-derived mast cells (BMMCs), as PMCs show stronger responses to Mrgpr agonists

    • Cell density optimization: typically 1-5 × 10⁴ cells per well in 96-well format

  • Calcium mobilization assay:

    • Load cells with calcium-sensitive dye (Fura-2/AM, 2-5 μM, 30-45 min incubation)

    • Wash cells to remove extracellular dye

    • Measure baseline fluorescence (340/380 nm excitation, 510 nm emission)

    • Add potential agonists and monitor real-time calcium responses

    • Include positive controls (known MRGPR agonists) and negative controls (buffer alone)

    • For mechanistic studies, pretreat with inhibitors (e.g., PI3K inhibitor wortmannin)

  • Mast cell degranulation assay:

    • Prepare PMCs from peritoneal lavage

    • Incubate cells with test compounds (30 min, 37°C)

    • Measure β-hexosaminidase release as percentage of total content

    • Calculate percent degranulation relative to controls

  • G protein activation assay:

    • Implement BRET-based G protein heterotrimer dissociation assay to assess coupling to different G protein subfamilies

    • Co-transfect cells with Mrgprg and BRET sensor constructs

    • Measure BRET signal changes upon agonist stimulation

  • Receptor internalization assay:

    • Express fluorescently tagged Mrgprg in cell lines

    • Monitor receptor localization before and after agonist exposure

    • Quantify internalization through confocal microscopy or flow cytometry

These protocols provide a comprehensive approach to characterizing Mrgprg activation mechanisms and can be adapted to specific research questions.

What imaging techniques are most informative for studying Mrgprg localization and trafficking?

Advanced imaging approaches for studying Mrgprg localization and trafficking include:

  • Receptor visualization strategies:

    • Fluorescent protein tagging (e.g., GFP, mCherry) at C-terminus with appropriate linkers

    • SNAP-tag or HaloTag labeling for pulse-chase trafficking studies

    • Antibody-based detection with epitope tags (HA, FLAG) when maintaining native structure is critical

    • Knock-in fluorescent reporters in animal models for endogenous expression studies

  • Subcellular localization techniques:

    • Confocal microscopy with organelle markers (plasma membrane, endosomes, Golgi)

    • Super-resolution microscopy (STORM, PALM) for nanoscale distribution analysis

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

    • FRET/BRET techniques to study receptor-protein interactions

  • Trafficking analysis approaches:

    • Live-cell imaging with temperature-controlled stages

    • Photoactivatable or photoconvertible tags for pulse-chase experiments

    • Co-localization with endocytic pathway markers (Rab5, Rab7, Rab11)

  • In vivo and ex vivo applications:

    • Two-photon microscopy for deeper tissue imaging

    • Intravital microscopy for real-time trafficking in living tissues

    • Tissue clearing techniques (CLARITY, iDISCO) for whole-tissue receptor mapping

    • Expansion microscopy for improved resolution in intact tissue samples

  • Co-localization studies:

    • Multi-color imaging with markers for:

      • Other MRGPRs to assess receptor clustering

      • Signaling molecules (G proteins, arrestins)

      • Cell-type specific markers to confirm expression patterns

These imaging approaches can reveal critical information about Mrgprg biology, including surface expression levels, internalization dynamics, recycling rates, and interaction partners.

What animal models are most appropriate for studying Mrgprg function in vivo?

Selecting appropriate animal models for Mrgprg research requires careful consideration of several factors:

  • Genetic models:

    • Conventional knockout mice (Mrgprg⁻/⁻) for complete loss-of-function studies

    • Conditional knockout models using Cre-loxP system for tissue-specific deletion

    • Knock-in models with reporter genes for expression tracking

    • Point mutation models using CRISPR/Cas9 to study specific polymorphisms

    • Humanized mice expressing human MRGPRG for translational studies

  • Species considerations:

    • Mice: Most detailed genetic tools available but caution required due to expanded MRGPR family

    • Rats: More conserved MRGPR pattern compared to mice, with single genes for certain subfamilies rather than expanded families

    • Gerbils: Similar to rats, have single MrgA and MrgC genes, potentially providing cleaner background for Mrgprg studies

  • Disease models compatible with Mrgprg studies:

    • Inflammatory pain models (Complete Freund's Adjuvant, carrageenan)

    • Itch models (compound 48/80, substance P)

    • Pseudoallergic reaction models (vancomycin administration)

    • Mast cell-dependent inflammation models

  • Practical experimental setups:

    • Behavioral assays (scratching behavior, pain sensitivity tests)

    • In vivo calcium imaging of neuronal responses

    • Tissue-specific mast cell reconstitution in mast cell-deficient mice

    • Adoptive transfer approaches with genetically modified cells

  • Readout considerations:

    • For skin inflammation: ear thickness, histopathology scoring

    • For systemic responses: core temperature, blood pressure

    • For cellular responses: tissue mast cell degranulation, immune cell infiltration

    • For molecular responses: cytokine/chemokine profiles, signaling pathway activation

When selecting animal models, researchers should carefully consider the specific aspects of Mrgprg biology under investigation and choose the most appropriate species and genetic background to address their research questions effectively.

What are the most promising avenues for drug discovery targeting Mrgprg?

Several promising approaches could accelerate drug discovery targeting Mrgprg:

  • Structure-based drug design:

    • Leverage recent structural advances in MRGPRs to develop Mrgprg-selective compounds

    • Focus on unique structural features of Mrgprg compared to other family members

    • Apply computational docking and virtual screening approaches to identify lead compounds

    • Design compounds that exploit the unique TM4-TM5 disulfide bond and ECL2 conformation

  • Biased ligand development:

    • Target specific downstream signaling pathways while avoiding others

    • Develop compounds that selectively activate beneficial pathways (e.g., analgesia) without triggering adverse effects

    • Distinguish between G protein-biased and balanced agonist profiles

    • Exploit G protein pathway selectivity for therapeutic specificity

  • Allosteric modulator discovery:

    • Target allosteric sites unique to Mrgprg

    • Develop positive allosteric modulators (PAMs) that enhance responses to endogenous ligands

    • Design negative allosteric modulators (NAMs) to dampen excessive signaling

    • Take advantage of the higher basal activity of MRGPRs through inverse agonists

  • Peptide-based therapeutics:

    • Develop modified peptides based on endogenous MRGPR ligands

    • Engineer stability and bioavailability improvements

    • Create peptide-small molecule conjugates for targeted delivery

    • Explore cyclic peptides for improved stability and selectivity

  • Therapeutic applications based on proposed functions:

    • Anti-inflammatory agents targeting mast cell activation

    • Analgesics for specific pain modalities

    • Anti-pruritic compounds for non-histaminergic itch

    • Preventive agents for pseudoallergic drug reactions

These approaches could lead to novel therapeutics addressing unmet medical needs, particularly in conditions involving aberrant Mrgprg signaling.

How might single-cell technologies advance our understanding of Mrgprg biology?

Single-cell technologies offer transformative potential for understanding Mrgprg biology:

  • Single-cell RNA sequencing applications:

    • Define precise cellular expression patterns of Mrgprg across tissues

    • Identify co-expression patterns with other receptors and signaling molecules

    • Discover previously unknown Mrgprg-expressing cell populations

    • Characterize heterogeneity within Mrgprg-expressing cells

    • Map developmental trajectories of Mrgprg-expressing lineages

  • Spatial transcriptomics approaches:

    • Visualize Mrgprg expression in anatomical context

    • Map spatial relationships between Mrgprg-expressing cells and interacting cell types

    • Correlate expression with microenvironmental features

    • Identify tissue niches supporting Mrgprg-expressing cells

  • Functional single-cell assays:

    • Single-cell calcium imaging to measure functional responses

    • Mass cytometry (CyTOF) to correlate Mrgprg expression with multiple functional markers

    • Microfluidic platforms for controlled single-cell stimulation and response measurement

    • Patch-seq for combining electrophysiology and transcriptomics in individual cells

  • Single-cell multi-omics integration:

    • Combined analysis of transcriptome, proteome, and epigenome in single cells

    • Correlation of Mrgprg expression with chromatin accessibility patterns

    • Identification of cell state-specific regulatory networks controlling Mrgprg

    • Analysis of post-translational modifications affecting Mrgprg function

  • Computational analysis approaches:

    • Trajectory inference to map dynamic changes in Mrgprg-expressing cells

    • Network analysis to identify key interaction partners

    • Machine learning for predictive modeling of Mrgprg signaling outcomes

    • Integration with public databases to contextualize findings

These technologies could resolve current knowledge gaps by providing unprecedented resolution of Mrgprg expression, regulation, and function at the single-cell level.

What unresolved questions about Mrgprg would have the highest impact if answered?

Several key knowledge gaps in Mrgprg biology represent high-impact research opportunities:

  • Endogenous ligand identification:

    • What are the physiological ligands for Mrgprg?

    • Are there tissue-specific ligands in different expression contexts?

    • How do endogenous ligands differ from pharmacological activators?

    • Do endogenous ligands exhibit biased signaling properties?

  • Physiological function clarification:

    • What is the primary physiological role of Mrgprg in tissues where it is expressed?

    • How does Mrgprg contribute to sensory perception, if at all?

    • Does Mrgprg serve redundant functions with other MRGPRs or unique roles?

    • What phenotypes emerge in Mrgprg knockout models under challenge conditions?

  • Signaling mechanism elucidation:

    • What is the complete G protein coupling profile of Mrgprg?

    • Does Mrgprg couple to non-G protein effectors like β-arrestins?

    • How does Mrgprg signaling integrate with other cellular signaling networks?

    • What regulatory mechanisms control Mrgprg signaling duration and intensity?

  • Disease relevance determination:

    • Is Mrgprg dysregulation associated with specific pathological conditions?

    • Do Mrgprg polymorphisms correlate with disease susceptibility?

    • Could Mrgprg-targeted therapies address unmet clinical needs?

    • What biomarkers might identify patients likely to benefit from Mrgprg-directed therapies?

  • Structural insights:

    • What is the three-dimensional structure of Mrgprg?

    • How does Mrgprg structure compare to other MRGPRs with known structures?

    • What structural features determine ligand selectivity?

    • How do conformational changes propagate from ligand binding to G protein coupling?

Answering these questions would significantly advance both fundamental understanding of Mrgprg biology and its potential therapeutic applications, particularly in inflammatory and sensory disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.