Recombinant Mouse Matrix metalloproteinase-25 (Mmp25)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mmp25; Matrix metalloproteinase-25; MMP-25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
163-593
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Mmp25
Target Protein Sequence
YSLSGSVWKKRTLTWSIRSFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEP DIIIHFARAYHQDSYPFDGSGGTLAHAFFPGEHPISGDTHFDDEETWTFGSTDDNGIDLF AVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYGRVSQNPNA RPTRKPLVPPPQPPAMPPDSPATPVPDRCEGNFDAVANIRGEIFLFKGPWFWRLQPSGQL VSPRPAGLHRFWEGLPTHVKVIQAAYARPLDGRIILFSGPQFWVFQERQLEGAARPLVEF GLPPGEDVDAVFSWPHNGKTYLIRGQKYWRYDEVAARPDPGYPRALSLWDGAPFAPDDVT ISNTGDTYFFKGTHFWRFAEGSVKAESDSPQPIGPKWLDCPAPNSDPRVTSPPKTTSKTR SCDCHCELNQA
Uniprot No.

Target Background

Function
May activate progelatinase A.
Gene References Into Functions
  1. This study demonstrates that MMP25-null mice exhibit impaired innate immune responses, characterized by reduced sensitivity to bacterial LPS, hypergammaglobulinemia, and decreased proinflammatory molecule secretion. PMID: 27259858
  2. These findings suggest that MMP-25 is a direct transcriptional target of TGF-β3 in mouse secondary palate development and may be a target for TGF-β3 in other contexts. PMID: 20809987
Database Links
Protein Families
Peptidase M10A family
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.

Q&A

What is Matrix Metalloproteinase-25 and what are its known functions?

Matrix Metalloproteinase-25 (MMP-25), also known as MT6-MMP, is a membrane-type matrix metalloproteinase that belongs to the broader MMP family of zinc-dependent endopeptidases. This protein has several identified functions:

  • Regulation of CD16 down-modulation in natural killer (NK) cells

  • Critical role in secondary palate (SP) development in mouse embryos

  • Functions as a proteinase that can cleave extracellular matrix components

  • Plays a role in cellular migration and tissue remodeling

MMP-25 is distinguished from other MMPs by its GPI anchor rather than a transmembrane domain, which affects its cellular localization and functional properties. In unstimulated cells, MMP-25 is primarily sequestered in intracellular compartments but can rapidly translocate to the cell surface upon stimulation .

What are the expression patterns of MMP-25 during mouse development?

MMP-25 shows distinct spatiotemporal expression patterns during mouse development, particularly well-documented in secondary palate formation:

Developmental StageMMP-25 Expression PatternLocalizationRelative Expression Level
E12.5Present in palate shelvesPrimarily epithelial with some mesenchymal expressionModerate
E13.5Expressed in growing palatal shelvesStrongest in epithelium and adjacent mesenchymeHighest
E14.5Concentrated in medial epitheliaHighest in areas where palatal shelves contactHigh
E15.5Significantly decreasedDiminished as fusion completesLow

MMP-25 expression is highest at E13.5 during palate development and significantly decreases by E15.5 as the medial edge seam (MES) degrades and development concludes . This pattern suggests a critical role during the active phase of palatal shelf growth and fusion.

How can MMP-25 protein and mRNA be detected in research samples?

Detection of MMP-25 can be accomplished through several complementary techniques:

For protein detection:

  • Immunohistochemistry (IHC) using specific anti-MMP-25 antibodies

  • Western blot analysis (typically revealing bands at approximately 57kDa)

  • Flow cytometry using unlabeled primary antibodies followed by fluorescently-conjugated secondary antibodies

  • For total protein levels, cells should be fixed and permeabilized to detect intracellular pools

For mRNA detection:

  • In situ hybridization (ISH) using specific probes targeting MMP-25 mRNA sequences

  • Quantitative real-time PCR for expression level quantification

  • RNA-seq for comprehensive transcriptomic profiling

When performing double staining experiments (e.g., CD16 and MMP-25), appropriate blocking steps with 5% serum are essential to prevent cross-reactivity between antibodies .

How can siRNA be effectively used to study MMP-25 function in developmental processes?

siRNA-mediated knockdown of MMP-25 has proven valuable for functional studies, particularly in palate development models. The methodological approach should include:

  • siRNA Selection and Optimization:

    • Use StealthTM RNAi MMP-25 siRNA or similar validated sequences

    • Determine optimal concentration (500nM has shown efficacy in palatal cultures)

    • Include appropriate scrambled siRNA controls

  • Delivery Method for Ex Vivo Cultures:

    • For palatal shelf cultures, apply siRNA directly to the culture medium

    • Consider transfection reagents compatible with tissue explants

    • For cell cultures, standard transfection protocols can be employed

  • Validation of Knockdown Efficiency:

    • Quantitative real-time PCR to verify mRNA reduction

    • Western blot analysis to confirm protein reduction

    • Include multiple time points to track knockdown duration

  • Functional Assessment:

    • For palatal cultures, histological analysis and fusion scoring systems

    • Mean Fusion Score (MFS) assessment on serial sections (scale 1-5)

    • Statistical analysis comparing experimental and control groups

In palatal development studies, MMP-25 siRNA treatment (500nM) resulted in a significant decrease in fusion capacity (MFS of 2.50 compared to control MFS of 4.14), demonstrating its critical role in this developmental process .

What role does MMP-25 play in immune cell function, particularly NK cells?

MMP-25/MT6-MMP has a significant regulatory role in NK cell function, particularly in antibody-dependent cellular cytotoxicity (ADCC):

  • Subcellular Localization and Trafficking:

    • In unstimulated NK cells, MMP-25 is sequestered in intracellular compartments

    • Upon IL-2 stimulation, MMP-25 translocates to the cell surface

    • During target cell engagement, MMP-25 polarizes to the immunological synapse

  • CD16 Regulation:

    • MMP-25 functions as a proteinase responsible for CD16 down-modulation

    • This process appears critical for NK cell functional cycling

    • Increased IL-2 levels correlate with MT6/MMP25 upregulation and CD16 down-regulation

  • Impact on ADCC:

    • siRNA-mediated disruption of MMP-25 expression enhances ADCC capacity

    • Inhibiting MMP-25 could potentially improve the therapeutic efficacy of administered NK cells

  • Experimental Protocols:

    • For studying MMP translocation: culture NK cells with IL-2 (500 U/ml) in serum-free medium

    • For MMP inhibition experiments: use GM6001 (10 μM) or 1,10-phenanthroline monohydrate (2 mM)

    • For surface release studies: pre-incubate cells with PE-conjugated antibodies before activation

These findings suggest that modulating MMP-25 activity could have therapeutic implications for NK cell-based immunotherapies.

How do researchers resolve contradictory findings in MMP-25 research?

Contradictions in MMP-25 research findings are not uncommon, reflecting both the complexity of MMP biology and the technical challenges in studying these enzymes. Researchers should employ the following strategies to address contradictions:

  • Systematic Literature Review:

    • Examine contradictory findings in context of experimental design differences

    • Consider differences in model systems (cell lines vs. primary cells vs. animal models)

    • Evaluate antibody specificity and detection methods used across studies

  • Experimental Validation:

    • Reproduce contradictory experiments with consistent protocols

    • Include multiple complementary techniques (e.g., both protein and mRNA analysis)

    • Employ both gain-of-function and loss-of-function approaches

  • Contextual Factors to Consider:

    • Species differences (human vs. mouse MMP-25 may have distinct functions)

    • Developmental timing (expression patterns change significantly during development)

    • Tissue-specific effects (epithelial vs. mesenchymal functions may differ)

    • Activation state of cells (unstimulated vs. cytokine-stimulated)

  • Statistical Approaches:

    • Meta-analysis of multiple studies when available

    • Appropriate statistical tests to determine significance of findings

    • Power analysis to ensure adequate sample sizes

The medical literature shows that approximately 16% of established clinical findings may be contradicted by subsequent studies, highlighting the importance of rigorous validation and replication in resolving contradictions .

What are the optimal conditions for recombinant MMP-25 expression and purification?

Successful expression and purification of recombinant mouse MMP-25 requires careful attention to several critical parameters:

  • Expression System Selection:

    • Mammalian expression systems (HEK293, CHO) preserve proper folding and post-translational modifications

    • E. coli systems may be suitable for truncated versions without the GPI anchor

    • Baculovirus/insect cell systems offer a compromise between yield and proper folding

  • Construct Design Considerations:

    • Include appropriate signal peptide for secretion

    • Consider tag location carefully (N-terminal tags are preferable as C-terminal may interfere with GPI anchor)

    • For active enzyme, include pro-domain and consider activation strategy

    • For structural studies, catalytic domain alone may be sufficient

  • Purification Protocol:

    • Two-step purification recommended (affinity chromatography followed by size exclusion)

    • Metal chelate affinity chromatography works well with His-tagged constructs

    • Include protease inhibitors during purification (except when studying the active enzyme)

    • Consider detergent inclusion for membrane-associated forms

  • Activity Preservation:

    • Store with metalloproteinase stabilizers (e.g., low concentrations of CaCl₂)

    • Include 10% glycerol in storage buffer

    • Aliquot and store at -80°C to avoid freeze-thaw cycles

    • Test activity using fluorogenic MMP substrates

What controls should be included when studying MMP-25 in developmental processes?

Rigorous experimental design for MMP-25 developmental studies should include multiple control types:

  • Genetic Controls:

    • Scrambled siRNA controls for knockdown studies

    • Empty vector controls for overexpression studies

    • Wild-type littermates for transgenic models

    • CRISPR non-targeting guides for gene editing approaches

  • Pharmacological Controls:

    • Broad-spectrum MMP inhibitors (GM6001 at 10 μM)

    • Metal chelators (1,10-phenanthroline monohydrate at 2 mM)

    • Vehicle controls (DMSO) for inhibitor studies

    • Dose-response curves to determine optimal inhibitor concentrations

  • Developmental Stage Controls:

    • Multiple timepoints to capture dynamic expression changes

    • Comparison across different developmental processes

    • Inclusion of known developmental markers as internal controls

  • Methodological Controls:

    • For in situ hybridization: sense probes

    • For immunohistochemistry: isotype antibody controls and peptide competition

    • For Western blotting: loading controls and recombinant protein standards

    • For qPCR: multiple reference genes and no-RT controls

In palatal development studies, wild-type control palatal cultures typically show a Mean Fusion Score of approximately 4.14, providing a useful benchmark for evaluating experimental interventions .

How can researchers effectively analyze contradictory data regarding MMP-25 function?

When confronted with contradictory findings about MMP-25 function, researchers should employ a systematic approach to analysis:

  • Data Triangulation:

    • Verify findings using multiple complementary techniques

    • Compare protein expression, mRNA levels, and functional outcomes

    • Consider temporal dynamics (short-term vs. long-term effects)

    • Evaluate dose-dependent relationships

  • Context-Specific Analysis:

    • Determine if contradictions result from different cellular contexts

    • Evaluate the activation state of the cells/tissues studied

    • Consider developmental stage differences

    • Assess potential compensatory mechanisms by other MMPs

  • Computational Approaches:

    • Use natural language processing to identify potentially contradictory literature

    • Apply ontology-driven analysis to systematically categorize findings

    • Employ statistical methods to evaluate the strength of evidence

    • Consider Bayesian approaches to weigh conflicting evidence

  • Collaboration Strategies:

    • Establish multi-lab validation protocols

    • Standardize experimental conditions across research groups

    • Share reagents (antibodies, constructs, cell lines) to reduce technical variability

    • Implement open science practices with detailed methodological reporting

When analyzing contradictory findings, researchers should note that apparent contradictions may reflect true biological complexity rather than experimental error. MMP-25 function may genuinely differ based on cellular context, developmental timing, or activation state .

What are the emerging technologies for studying MMP-25 activity in vivo?

Several advanced technologies are revolutionizing the study of MMP-25 activity in living systems:

  • Activity-Based Probes:

    • Fluorescent substrate-based probes that become activated upon MMP-25 cleavage

    • Quenched-fluorescent peptide substrates with specificity for MMP-25

    • Photoactivatable probes that can be spatially and temporally controlled

    • Bioluminescent reporters linked to MMP-25 substrate sequences

  • Live Imaging Approaches:

    • Fluorescence resonance energy transfer (FRET)-based biosensors

    • MMP-25-specific substrate conjugated to quantum dots for long-term tracking

    • Light-sheet microscopy for whole-tissue imaging of MMP-25 activity

    • Intravital microscopy for in vivo visualization in animal models

  • Genetic Tools:

    • Conditional knockouts using tissue-specific Cre-lox systems

    • CRISPR-Cas9 gene editing for endogenous tagging of MMP-25

    • Transgenic reporter mice expressing fluorescent proteins under MMP-25 promoters

    • Inducible expression systems for temporal control of MMP-25 manipulation

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify cell populations expressing MMP-25

    • Spatial transcriptomics to map MMP-25 expression within tissue architecture

    • Mass cytometry to simultaneously detect multiple proteins including MMP-25

    • Microfluidic platforms for analyzing MMP-25 activity in individual cells

How does glycosylation affect MMP-25 function and activity?

The relationship between glycosylation and MMP-25 function represents an important area of research:

  • Glycosylation Patterns:

    • MMP-25 contains multiple potential N-glycosylation sites

    • Glycosylation patterns may vary between tissues and developmental stages

    • Different glycoforms may exhibit altered substrate specificities

    • Glycosylation may affect protein stability and half-life

  • Functional Implications:

    • Glycosylation can influence enzyme activity and substrate recognition

    • Proper glycosylation may be required for trafficking to the cell surface

    • Glycosylation may protect MMP-25 from proteolytic degradation

    • Interactions with other proteins may be modulated by glycosylation state

  • Experimental Approaches:

    • Site-directed mutagenesis of N-glycosylation sites

    • Treatment with glycosidases to remove specific sugar moieties

    • Lectin affinity chromatography to separate glycoforms

    • Mass spectrometry to characterize glycosylation patterns

  • Analytical Methods:

    • Glycoproteomic analysis to identify site-specific glycosylation

    • Enzymatic activity assays comparing different glycoforms

    • Cellular localization studies of glycosylation mutants

    • Protein stability assays under various deglycosylation conditions

Understanding MMP-25 glycosylation has potential implications for therapeutic development and may explain some of the contradictory findings in the literature.

What are the most promising therapeutic applications targeting MMP-25?

Based on current research, several therapeutic directions show particular promise:

  • NK Cell-Based Immunotherapies:

    • Inhibition of MMP-25 could enhance ADCC efficacy of therapeutic NK cells

    • Temporary MMP-25 suppression may improve NK cell persistence and function

    • Combined approaches targeting both MMP-25 and stimulatory receptors may optimize NK cell activity

  • Developmental Disorder Treatments:

    • MMP-25 modulation could potentially address certain congenital abnormalities

    • Palatal development disorders might benefit from carefully timed MMP-25 manipulation

    • Prenatal interventions targeting MMP-25 pathways could reduce developmental defects

  • Tissue Engineering Applications:

    • Controlled MMP-25 expression could facilitate tissue remodeling

    • Scaffold materials incorporating MMP-25-sensitive elements

    • Cell-based therapies with optimized MMP-25 expression profiles

  • Diagnostic Applications:

    • MMP-25 as a biomarker for specific developmental or pathological processes

    • Imaging probes targeting MMP-25 activity for non-invasive diagnostics

    • Liquid biopsy approaches detecting MMP-25 levels or activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.