Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Opn1mw; Gcp; Medium-wave-sensitive opsin 1; Green cone photoreceptor pigment; Green-sensitive opsin; M opsin; Medium wavelength-sensitive cone opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAQRLTGEQTLDHYEDSTHASIFTYTNSNSTKGPFEGPNYHIAPRWVYHLTSTWMILVVV ASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPL CVIEGYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAIWTA PPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLA IRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYAFHPLVAS LPSYFAKSATIYNPIIYVFMNRQFRNCILHLFGKKVDDSSELSSTSKTEVSSVSSVSPA
Uniprot No.

Target Background

Function
Visual pigments are light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. These pigments may enhance spectral sensitivity in dim light conditions.
Gene References Into Functions
  1. This study describes the creation and validation of two lines of genetically engineered mice. These mice can be used to study disease-causing variants of human L/M-opsins in vivo. PMID: 24801621
  2. Luciferase expression driven by the midwavelength sensitive opsin intron 3-4 region was only slightly increased by THRB2, but rather enhanced by COUP-TFII. PMID: 24058409
  3. Ectopically expressed cTalpha 1) forms a heterotrimeric complex with rod Gbeta(1)gamma(1), and substitutes equally for rTalpha in generating photoresponses initiated by either rhodopsin or S-cone opsin PMID: 23288843
  4. These results show that UV-opsin suppression successively ceases in the presence of M-opsin activating background light, which implies that cone light adaptation is controlled at the opsin stage, before activation of transducin. PMID: 12511072
  5. Alpha transducin and opsin play roles in mouse photoreceptor cell responses to light and dark PMID: 17249565

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in retina (at protein level). Expressed in cone photoreceptor cells (at protein level).

Q&A

What is the function of Opn1mw in mouse visual systems?

The Opn1mw gene encodes a photopigment that is essential for normal color vision in mice. This opsin protein is expressed in cone photoreceptors of the retina and is most sensitive to middle-wavelength light (yellow/green part of the visible spectrum). In response to light stimulation, the Opn1mw photopigment triggers a series of chemical reactions within the cone cell that ultimately generates an electrical signal transmitted to the brain .

Unlike humans, most mouse cones coexpress both M-opsin (Opn1mw) and S-opsin (Opn1sw) in a dorsal-ventral gradient, with dorsal cones predominantly expressing M-opsin and ventral cones predominantly expressing S-opsin . This expression pattern contributes to the unique spectral sensitivity profile of the mouse visual system, which differs from the trichromatic vision of humans.

How does mouse Opn1mw differ from human OPN1MW?

Mouse Opn1mw and human OPN1MW share functional similarity as middle-wavelength sensitive opsins, but have several important differences:

  • Expression pattern: In humans, OPN1MW is exclusively expressed in dedicated M-cones, while in mice, Opn1mw is coexpressed with S-opsin in most cones in a gradient pattern .

  • Genetic organization: Human OPN1MW genes are arranged in a tandem array with OPN1LW on the X chromosome, and humans can have one or more copies of the OPN1MW gene . The mouse genome has a simpler organization without the complex duplication seen in humans.

  • Spectral sensitivity: Though both are middle-wavelength sensitive, the peak sensitivity wavelengths differ slightly between mouse and human proteins.

  • Evolutionary context: The human OPN1MW gene arose from a relatively recent gene duplication event on the X chromosome, sharing high sequence similarity with OPN1LW, which creates diagnostic challenges . Mouse Opn1mw evolved separately.

What phenotypes are observed in Opn1mw knockout mice?

Opn1mw knockout mice (Opn1mw−/−) display several characteristic phenotypes:

In contrast, Opn1mw−/−/Opn1sw−/− double knockout mice (lacking both M- and S-opsins) completely lack photopic ERG responses and undergo rapid cone degeneration, making them a more severe model of congenital cone dysfunction .

What are the standard methods for genotyping Opn1mw knockout mice?

Standard genotyping protocols for Opn1mw knockout mice typically include:

  • PCR-based genotyping: Using specific primer sets that distinguish between wild-type and knockout alleles. This approach typically targets sequences flanking the engineered deletion or insertion in the knockout construct.

  • Restriction fragment length polymorphism (RFLP) analysis: For certain knockout constructs, restriction enzyme digestion patterns can be used to distinguish between genotypes.

  • Quantitative PCR (qPCR): For determinations requiring gene copy number assessment, qPCR targeting the Opn1mw gene relative to reference genes can be used.

According to published protocols, genotyping of Opn1mw−/−/Opn1sw−/− mice is performed using established methods as described in previous literature . When working with these models, it's important to follow the specific genotyping protocols provided by the originating laboratory or repository, as the exact knockout strategy can vary between different mouse lines.

What are the optimal parameters for AAV-mediated gene therapy targeting Opn1mw in mouse models?

Successful AAV-mediated gene therapy targeting Opn1mw requires optimization of several parameters:

  • Vector selection: AAV vectors capable of efficient transduction of cone photoreceptors (such as AAV5, AAV8, or AAV9) are typically preferred for Opn1mw gene delivery.

  • Age of intervention: Research shows that early intervention is crucial. In Opn1mw−/−/Opn1sw−/− mice, treatment efficacy significantly decreases when therapy is administered after 2 months of age. Mice treated at 5 and 7 months showed reduced rescue effectiveness despite cones still being present .

  • Injection technique: Subretinal injection is the preferred delivery method, as it places the vector in direct contact with photoreceptors. The procedure must be carefully performed to minimize retinal damage while ensuring adequate vector distribution.

  • Promoter selection: Cone-specific promoters (such as PR2.1 or mCAR) provide targeted expression in cone photoreceptors, minimizing off-target effects in other retinal cells.

  • Expression level: Studies indicate that the level of opsin expression must be carefully controlled, as both insufficient and excessive expression can be detrimental to cone function and survival.

Research has demonstrated that AAV-mediated expression of human L-opsin can promote cone outer segment regeneration and rescue cone-mediated function in Opn1mw−/−/Opn1sw−/− mice, with functional rescue maintained for at least 8 months post-treatment when administered at an early age .

How does the absence of Opn1mw affect the structural integrity of cone photoreceptors over time?

The absence of Opn1mw has progressive structural effects on cone photoreceptors:

  • Initial structural abnormalities: Opn1mw−/− mice develop significantly shortened cone outer segments, even though cone density remains relatively normal initially .

  • Temporal progression: In contrast to single knockout mice, Opn1mw−/−/Opn1sw−/− double knockout mice show much more rapid degeneration, suggesting that expression of any opsin protein (even at low levels) provides some protective effect for cone structural integrity .

  • Cellular stress: Cones lacking Opn1mw may experience cellular stress due to improper protein trafficking and endoplasmic reticulum (ER) stress, though interestingly, crossing Opn1mw−/−/Opn1sw−/− mice with proteasomal activity reporter mice did not reveal GFP accumulation in cones, suggesting that impaired degradation of ubiquitinated proteins is not a primary stress factor contributing to cone loss .

  • Age-dependent vulnerability: Rescue experiments showed that cone photoreceptors remain viable and responsive to gene therapy in young mice (≤2 months), but the therapeutic window narrows with age, indicating progressive cellular changes that eventually render cones non-responsive to opsin reintroduction .

This temporal dependence of structural rescue highlights the importance of understanding the molecular mechanisms underlying cone degeneration in the absence of opsins.

What molecular mechanisms underlie cone degeneration in Opn1mw−/−/Opn1sw−/− double knockout mice?

The molecular mechanisms underlying cone degeneration in Opn1mw−/−/Opn1sw−/− mice are complex and involve multiple pathways:

  • Absence of photopigment-dependent trophic support: Opsins may provide structural support to cone outer segments beyond their role in phototransduction. Complete absence of both M- and S-opsins in double knockout mice leads to rapid degeneration compared to single knockouts .

  • Protein trafficking defects: Without opsins to transport to outer segments, the normal protein trafficking machinery in cones may become dysregulated, leading to cellular stress.

  • Metabolic dysregulation: Cones have high metabolic demands, and absence of normal phototransduction may disrupt metabolic homeostasis, contributing to degeneration.

  • Non-proteasomal stress factors: Intriguingly, crossing Opn1mw−/−/Opn1sw−/− mice with proteasomal activity reporter mice (UbG76V–GFP) did not reveal GFP accumulation in cones, suggesting that impaired degradation of ubiquitinated proteins is not a primary stress factor contributing to cone loss . This finding indicates that alternative cellular stress pathways must be investigated.

  • Cell death pathways: The specific apoptotic or non-apoptotic cell death pathways activated in Opn1mw−/−/Opn1sw−/− cones remain to be fully characterized.

Understanding these mechanisms is crucial for developing effective therapeutic interventions beyond gene augmentation.

How can researchers distinguish between functional rescue and transient improvements in gene therapy studies using Opn1mw knockout models?

Distinguishing true functional rescue from transient improvements requires comprehensive assessment using multiple complementary approaches:

  • Long-term functional monitoring: Sustained functional rescue should be verified through longitudinal assessment. Studies have shown that properly executed gene therapy can maintain cone-mediated function for at least 8 months post-treatment in Opn1mw−/−/Opn1sw−/− mice .

  • Multi-modal functional assessment:

    • Electroretinography (ERG): Quantifies retina-wide photoreceptor function

    • Visually-guided behavior tests: Assess functional vision at the behavioral level

    • Optomotor response: Measures reflex-based visual function

  • Structural correlates of rescue:

    • Cone outer segment regeneration: True rescue should restore cone outer segment structure

    • Cone survival quantification: Count cone nuclei using cone-specific markers

    • Protein localization: Confirm proper trafficking of introduced opsin to outer segments

  • Molecular markers of rescue:

    • Gene expression profiling: Rescued cones should show normalization of transcriptome

    • Protein expression analysis: Western blotting or immunohistochemistry to quantify protein levels

  • Control for non-specific effects:

    • Inclusion of proper controls: Age-matched untreated controls and sham-injected controls

    • Viral capsid-only controls: To distinguish between effects of viral transduction versus transgene expression

Researchers should report both positive and negative outcomes across these multiple parameters to provide a comprehensive assessment of therapeutic efficacy.

What are the technical challenges in generating recombinant Opn1mw for in vitro studies?

Generating functional recombinant Opn1mw for in vitro studies presents several technical challenges:

  • Protein folding and stability: Opsin proteins are inherently unstable outside their native membrane environment. Successful expression requires careful optimization of buffer conditions, detergents, and stabilizing agents.

  • Post-translational modifications: Proper glycosylation and palmitoylation are essential for opsin function. Expression systems must be capable of performing these modifications correctly.

  • Chromophore binding: Functional reconstitution requires binding of the chromophore (11-cis-retinal) to form the active photopigment. This process must be performed under red light conditions to prevent premature photoactivation.

  • Expression system selection:

    • Mammalian cell systems: Provide appropriate post-translational modifications but have lower yields

    • Insect cell systems: Offer higher expression levels but may have differences in glycosylation patterns

    • Cell-free systems: Allow for rapid production but often struggle with membrane protein expression

  • Purification challenges:

    • Detergent selection: Critical for extracting opsins from membranes without denaturing them

    • Chromatography methods: Affinity tags must be carefully positioned to avoid interfering with function

    • Protein aggregation: Preventing aggregation during concentration steps

  • Functional verification: Confirming that recombinant Opn1mw retains native spectral sensitivity and activation properties requires specialized equipment for measuring light-induced conformational changes.

Researchers must carefully optimize each of these parameters when generating recombinant Opn1mw for structure-function studies or as reagents for other applications.

How do genetic testing approaches for OPN1MW differ between mouse models and human patients?

Genetic testing approaches for OPN1MW differ significantly between mouse models and human patients due to fundamental differences in gene organization:

  • Gene complexity differences:

    • Human OPN1MW: Part of a complex gene cluster with high sequence similarity to OPN1LW, presence of hybrid genes, and variable copy numbers. The human OPN1LW-OPN1MW gene cluster consists of segmental duplications arranged as tandem low copy repeats with a unit size of about 39 kb .

    • Mouse Opn1mw: Single-copy gene with simpler genomic context, making standard genotyping approaches more straightforward.

  • Testing methodologies for human patients:

    • Multiplex Ligation-Dependent Probe Amplification (MLPA): Used to determine copy number variations

    • Long-Read Sequencing: Helps resolve complex structural arrangements

    • Optical Genome Mapping (OGM): Provides visualization of large structural variations

    • Long-distance PCR with specific primers: Must account for the presence of insertion sequences that may occur in multiple copies of the gene cluster

  • Technical challenges in human testing:

    • Expression gradient effect: Only the first two gene copies nearest to the locus control region (LCR) significantly contribute to phenotype

    • Segmental insertion elements: Present in varying copy numbers across individuals

    • Hybrid gene identification: Detecting OPN1LWxOPN1MW or OPN1MWxOPN1LW hybrid genes

  • Mouse genotyping approaches:

    • Standard PCR: Typically sufficient for distinguishing wild-type and knockout alleles

    • Restriction fragment analysis: Used for certain knockout constructs

    • Quantitative PCR: Applied when gene dosage information is needed

This contrast highlights why human genetic diagnostics for color vision disorders require more sophisticated approaches compared to mouse model genotyping.

What is the therapeutic window for gene therapy in Opn1mw-related vision disorders?

The therapeutic window for gene therapy in Opn1mw-related vision disorders is influenced by several factors:

  • Age-dependent efficacy: Research in Opn1mw−/−/Opn1sw−/− mice demonstrates that early intervention is crucial. AAV-mediated expression of human L-opsin successfully rescued cone structure and function when mice were treated at ≤2 months of age, but efficacy was significantly reduced when treatment was delayed to 5 or 7 months, despite cones still being present in the retina .

  • Cone viability factors:

    • Cone survival timeline: The presence of cones does not guarantee responsiveness to therapy

    • Structural changes: Progressive changes in surviving cones may render them less responsive to opsin reintroduction

    • Supporting cell interactions: Changes in retinal pigment epithelium and other supporting cells may impact rescue potential

  • Model-dependent variables:

    • Single vs. double knockouts: Opn1mw−/− mice have more stable cones than Opn1mw−/−/Opn1sw−/− mice, suggesting that any opsin expression (even at low levels) extends the therapeutic window

    • Disease mechanism: The therapeutic window may differ between congenital absence versus progressive degeneration models

  • Outcome measure considerations:

    • Structural vs. functional rescue: Cone outer segment regeneration may occur without full functional recovery

    • Visual behavior thresholds: Different visual tasks may have different thresholds for detecting therapeutic benefit

The finding that early intervention is crucial for successful therapy has important implications for clinical translation, suggesting that genetic screening and early diagnosis of opsin-related disorders in humans would be essential for maximizing therapeutic outcomes.

How do mouse models of Opn1mw deficiency compare to human color vision disorders?

Mouse models of Opn1mw deficiency provide valuable insights but also have important limitations when compared to human color vision disorders:

FeatureMouse ModelsHuman DisordersImplications for Research
Cone opsin expression patternCo-expression of M- and S-opsins in most cones in a dorsal-ventral gradientOne opsin type per cone; separate L-, M-, and S-cone populationsMouse models don't fully recapitulate human cone type specificity
Visual system organizationDichromatic visionTrichromatic visionMouse models cannot fully capture human color discrimination deficits
Gene organizationSingle copy of Opn1mwComplex OPN1LW-OPN1MW array with multiple gene copies, hybrid genes, and variable expressionMouse models simplify the genetic complexity of human color vision disorders
Disease progressionOpn1mw−/− have stable cones; Opn1mw−/−/Opn1sw−/− undergo rapid degenerationVariable progression depending on specific gene mutationsDouble knockout mice may better model severe forms of human disease like Blue Cone Monochromacy
Cone function assessmentLimited behavioral tests of color discriminationRich psychophysical tests of color perceptionTranslation between mouse and human visual function requires careful interpretation

Despite these differences, studies in Opn1mw−/−/Opn1sw−/− mice have demonstrated that AAV-mediated gene augmentation therapy can rescue cone structure and function in a model with congenital opsin deletion, providing proof-of-concept for similar approaches in humans with conditions like Blue Cone Monochromacy .

What molecular markers indicate successful rescue of Opn1mw-deficient photoreceptors?

Several molecular markers can be used to evaluate successful rescue of Opn1mw-deficient photoreceptors:

  • Structural markers:

    • Cone arrestin: Indicates preservation of cone identity

    • Peanut agglutinin (PNA): Labels cone matrix sheaths, used to identify cone outer segments

    • Wheat germ agglutinin (WGA): Can be used to visualize outer segments

    • Cone opsin localization: Proper trafficking to the outer segment indicates functional protein processing

  • Functional indicators:

    • Photoreceptor-specific gene expression profiles: Transcriptomic normalization

    • Phototransduction cascade proteins: Expression of downstream signaling molecules

    • Calcium imaging responses: Direct measurement of light-induced signaling

  • Stress response markers:

    • Endoplasmic reticulum stress markers: Reduction indicates improved protein homeostasis

    • Ubiquitin-proteasome system activity: Monitored using reporter systems like UbG76V–GFP

    • Inflammatory markers: Reduction suggests improved cellular health

  • Survival markers:

    • Anti-apoptotic factor expression: Indicates reduced cell death signaling

    • Cell cycle arrest markers: Shows stabilization of post-mitotic state

    • Metabolic enzyme patterns: Normalization of energy production pathways

  • Synaptic markers:

    • Synaptic vesicle proteins: Indicates maintenance of synaptic machinery

    • Postsynaptic density proteins: Shows preservation of connections to second-order neurons

The combination of these markers provides a comprehensive assessment of the cellular and molecular aspects of photoreceptor rescue beyond simple survival or gross morphological preservation.

What are the optimal controls for gene therapy studies in Opn1mw knockout mice?

Rigorous experimental design for gene therapy studies in Opn1mw knockout mice requires multiple control groups:

  • Untreated controls:

    • Age-matched untreated Opn1mw−/− mice: Essential baseline for natural disease progression

    • Wild-type controls: Represent normal function targets for rescue metrics

  • Procedural controls:

    • Vehicle-only injections: Control for mechanical/inflammatory effects of the injection procedure

    • Empty vector controls: Differentiate between effects of viral transduction versus therapeutic transgene

  • Dosage controls:

    • Dose-response series: Multiple vector doses to establish optimal therapeutic window

    • Promoter strength variants: Control for effects of expression level versus therapeutic effect

  • Temporal controls:

    • Treatment at different ages: Define therapeutic window, as demonstrated in studies showing reduced efficacy when treatment was delayed beyond 2 months of age

    • Longitudinal assessment: Multiple timepoints post-treatment to distinguish transient from sustained effects

  • Construct specificity controls:

    • Alternative opsin variants: Test whether rescue is opsin-specific or if any opsin provides benefit

    • Non-functional opsin mutants: Distinguish structural from functional roles of the protein

  • Reporter controls:

    • Fluorescent protein co-expression: Monitor transduction efficiency

    • Separated opsin and reporter constructs: Control for potential interference

How should researchers design experiments to study the molecular consequences of Opn1mw deficiency?

Effective experimental design for studying molecular consequences of Opn1mw deficiency requires multi-level approaches:

  • Temporal analysis strategies:

    • Developmental time course: Sample multiple timepoints from early development through adulthood

    • Pre-degeneration focus: Capture molecular changes preceding visible structural degeneration

    • Longitudinal imaging: When possible, track individual animals over time

  • Cell type-specific approaches:

    • Single-cell transcriptomics: Distinguish cone-specific changes from secondary effects

    • Cone isolation techniques: FACS sorting or laser capture microdissection

    • Reporter lines: Fluorescent protein expression in cones for identification

  • Pathway analysis techniques:

    • Proteomics: Quantify changes in protein expression and post-translational modifications

    • Metabolomics: Identify alterations in metabolic pathways and energetics

    • Phosphoproteomics: Map changes in signaling cascades

  • Comparative model systems:

    • Single vs. double knockouts: Compare Opn1mw−/− with Opn1mw−/−/Opn1sw−/− to identify opsin-specific versus general cone maintenance mechanisms

    • Conditional knockouts: Temporally controlled gene deletion to separate developmental from maintenance roles

    • Cross-species validation: Validate findings in other model systems

  • Stress pathway investigation:

    • Ubiquitin-proteasome system: Use reporter lines like UbG76V–GFP

    • Endoplasmic reticulum stress: Monitor unfolded protein response activation

    • Oxidative stress markers: Assess redox imbalance and antioxidant responses

  • Functional correlates:

    • Structure-function correlation: Pair molecular analysis with functional assessments

    • Rescue experiments: Use targeted interventions to validate pathway involvement

These approaches should be integrated into a comprehensive experimental design that connects molecular mechanisms to cellular phenotypes and ultimately to visual function.

What are the challenges in interpreting visual function tests in Opn1mw knockout mouse models?

Interpreting visual function tests in Opn1mw knockout mouse models presents several challenges:

  • Species-specific visual system differences:

    • Cone distribution: Unlike humans, mice have a dorsal-ventral gradient of opsin expression

    • Spectral sensitivity: Mouse visual system is adapted for different light environments than humans

    • Rod dominance: Mouse retina is rod-dominant, potentially masking subtle cone deficits

  • Test selection considerations:

    • Electroretinography (ERG):

      • Isolating cone responses requires careful stimulus design

      • Background adaptation state critically affects results

      • Full-field ERG may miss localized defects

    • Behavioral tests:

      • Optomotor responses primarily assess motion detection rather than color vision

      • Visual discrimination tasks require extensive training and control for non-visual cues

      • Natural behaviors may not directly translate to clinical visual measures

  • Genotype-specific challenges:

    • Single Opn1mw knockout: Residual S-opsin expression in dorsal cones complicates interpretation

    • Double Opn1mw/Opn1sw knockout: Complete lack of cone function better models severe human disease but may limit assessment of partial therapeutic effects

  • Rescue assessment complexities:

    • Partial transduction: Incomplete viral transduction creates mixed populations of rescued and non-rescued cones

    • Threshold effects: Visual behavior may require a minimum percentage of functional cones

    • Compensatory mechanisms: Natural adaptation may mask functional deficits or exaggerate improvements

  • Age-dependent variables:

    • Developmental plasticity: Younger animals may show greater adaptive capacity

    • Progressive degeneration: Baseline function declines with age in some models, complicating longitudinal assessment

What novel approaches could improve the efficacy of gene therapy for Opn1mw-related disorders?

Several innovative approaches could enhance gene therapy efficacy for Opn1mw-related disorders:

  • Advanced vector design:

    • Engineered capsids: Development of AAV variants with enhanced cone tropism

    • Regulatory elements: Improved promoters with physiological expression levels

    • Dual-function vectors: Combined delivery of opsin genes with neuroprotective factors

  • Temporal optimization strategies:

    • Developmental timing: Intervention during critical periods of retinal development

    • Rescue window extension: Approaches to extend the therapeutic window beyond the current limit of 2 months in mouse models

    • Preparation for delayed treatment: Pre-treatment with factors that maintain cone viability before opsin gene delivery

  • Cellular stress management approaches:

    • Unfolded protein response modulation: Co-delivery of chaperones or UPR regulators

    • Metabolic optimization: Supporting cone energy requirements during rescue

    • Anti-apoptotic factors: Preventing cell death during the transition period

  • Combinatorial therapies:

    • Gene therapy + pharmacological approaches: Combining opsin replacement with small molecule enhancers

    • Optogenetic augmentation: Supplementing opsin function with non-native photosensitive channels

    • Retinal remodeling prevention: Maintaining retinal circuitry during rescue process

  • Delivery innovations:

    • Non-viral gene delivery systems: Nanoparticle-based approaches with reduced immunogenicity

    • In situ gene editing: CRISPR-based strategies for correcting opsin mutations

    • Sustained expression systems: Technologies ensuring long-term therapeutic gene expression

These approaches address the key limitations identified in current gene therapy studies, particularly the critical importance of early intervention and the challenges of rescuing cones after prolonged opsin deficiency .

How might findings from Opn1mw knockout mouse studies translate to human color vision disorders?

Translating findings from Opn1mw knockout mouse studies to human color vision disorders requires careful consideration of several factors:

  • Therapeutic implications:

    • Timing criticality: The finding that early intervention is crucial in mouse models (≤2 months) suggests that early diagnosis and treatment would be essential in human patients

    • Rescue potential: Successful structural and functional rescue in mice with congenital opsin deletion provides proof-of-concept for similar approaches in humans with conditions like Blue Cone Monochromacy

    • Longevity of effect: The 8+ month durability of rescue in mice suggests potential for long-term benefits in humans

  • Biological parallels and differences:

    • Cone viability: Both species show that cones can survive without opsin expression for a limited time window

    • Opsin coexpression: Human cones express a single opsin type, unlike mouse cones with coexpression, potentially affecting rescue strategies

    • Retinal architecture: Differences in cone density and distribution must be considered in translational approaches

  • Clinical applications:

    • Disease prioritization: Conditions with complete opsin deletion (e.g., Blue Cone Monochromacy) may be priority candidates for gene augmentation approaches

    • Outcome measures: Visual acuity and color discrimination tests in humans will provide more nuanced assessment than possible in mice

    • Injection strategies: The larger human eye allows for more precise targeting of macular versus peripheral retina

  • Genetic complexity considerations:

    • Array architecture: The complex OPN1LW-OPN1MW gene array in humans creates additional challenges for gene therapy design

    • Hybrid genes: Strategies must account for potential OPN1LWxOPN1MW hybrid genes in humans

    • Position effects: Expression gradient from the locus control region affects which gene copies are functionally relevant

The successful demonstration that AAV-mediated gene therapy can rescue cones lacking opsin expression provides strong justification for pursuing similar approaches in human patients, while recognizing the need for adaptations to address species-specific differences.

What are the emerging technologies for studying protein-protein interactions involving Opn1mw?

Emerging technologies for studying protein-protein interactions involving Opn1mw include:

  • Proximity labeling approaches:

    • BioID/TurboID: Engineered biotin ligases fused to Opn1mw label proximal proteins in living cells

    • APEX2 proximity labeling: Peroxidase-based approach for temporally controlled protein interaction mapping

    • Split-BioID systems: Allow detection of specific interaction-dependent labeling events

  • Advanced imaging techniques:

    • Super-resolution microscopy: Techniques like STORM and PALM enable visualization of protein complexes beyond the diffraction limit

    • Expansion microscopy: Physical expansion of specimens for enhanced resolution of protein localization

    • Lattice light-sheet microscopy: Enables dynamic imaging of protein interactions in living cells

  • Structural biology innovations:

    • Cryo-electron microscopy: Allows visualization of membrane protein complexes in near-native states

    • Integrative structural biology: Combining multiple techniques (X-ray, NMR, cryo-EM) for complete structural models

    • Mass photometry: Measures mass distribution of protein complexes in solution

  • Functional interaction assays:

    • Optical biosensors: FRET-based sensors to detect conformational changes upon protein binding

    • Nanobody-based probes: Highly specific detection of protein states in living cells

    • Single-molecule pull-down: Detection of individual protein complexes and their stoichiometry

  • Computational approaches:

    • Molecular dynamics simulations: Predict dynamic interactions between Opn1mw and partner proteins

    • Machine learning prediction: AI-based prediction of protein interaction networks

    • Integrative network analysis: Combining multiple datasets to generate comprehensive interaction maps

These technologies enable researchers to move beyond traditional co-immunoprecipitation approaches to study the dynamic interactions of Opn1mw with other proteins in its native cellular context, potentially revealing new therapeutic targets for opsin-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.