Recombinant Mouse Melatonin receptor type 1A (Mtnr1a)

Shipped with Ice Packs
In Stock

Description

Functional Insights

MT1 receptors mediate melatonin’s effects through Gi/o and Gq signaling pathways, influencing:

  • Circadian Rhythms: Modulates suprachiasmatic nucleus (SCN) neuronal activity and CREB phosphorylation .

  • Sleep Regulation: MT1 knockout mice exhibit altered non-REM (NREM) sleep during dark phases .

  • Reproductive Functions: Linked to photoperiodic control in the hypophysial pars tuberalis .

Signaling Pathways:

PathwayMechanismPhysiological Impact
Gi/cAMP InhibitionReduces cAMP production via adenylate cyclaseRegulates circadian clock genes
Gq/PLC ActivationTriggers Ca²⁺ release and PKC signalingEnhances retinal light sensitivity
HeteromerizationForms MT1/MT2 complexes with amplified Gq signalingModulates retinal and SCN functions

3.1. Knockout Mouse Studies

  • MT1⁻/⁻ Mice:

    • Loss of melatonin-induced SCN neuronal inhibition .

    • Reduced wakefulness during dark phases and disrupted REM sleep rhythms .

  • MT1/MT2 Double Knockouts: Exhibit compounded sleep dysregulation, emphasizing receptor interplay .

3.2. RFP-MT1 Transgenic Model

A BAC transgenic mouse expressing red fluorescent protein (RFP) under the Mtnr1a promoter revealed MT1 localization in:

  • Brain Regions: Cerebellum, habenula, and ependymal linings of ventricles .

  • Absence in SCN: Contrary to prior binding studies, suggesting transcriptional regulation complexities .

Ligands and Selectivity:

LigandActivity (Mouse MT1)Selectivity Notes
MelatoninFull agonistBinds MT1/MT2 with nanomolar affinity
4P-PDOTMT2-preferring antagonistWeak MT1 inhibition in mice
IIK7MT2-selective agonistActivates MT1 at high doses in heteromers

Key Finding: Mouse MT1/MT2 heteromers exhibit enhanced signaling efficiency compared to homomers, particularly in Gq pathways .

Applications in Research

Recombinant MT1 is critical for:

  1. Drug Development: Screening agonists/antagonists for sleep disorders or metabolic diseases .

  2. Localization Studies: Transgenic models (e.g., RFP-MT1 mice) map receptor distribution .

  3. Mechanistic Studies: Resolving signaling crosstalk in heteromers .

Challenges and Future Directions

  • Species-Specific Differences: Ligand selectivity varies between human and mouse MT1, complicating translational studies .

  • Unresolved Localization: Discrepancies in SCN MT1 detection highlight need for improved transgenic models .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please remark your requirement when placing the order. We will prepare according to your demand.
Lead Time
Delivery time may differ based on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mtnr1a; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MKGNVSELLNATQQAPGGGEGGRPRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKK LRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLHCQVSAFLMGLSVIGSIFN ITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWMLTLIAIMPNLQTGTLQYDPRIYSC TFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIWVLVLQVRRRVKPDNKPKLKPQDFRNF VTMFVVFVLFAICWAPLNLIGLIVASDPATMVPRIPEWLFVASYYLAYFNSCLNAIIYGL LNQNFRKEYKKIIVSLCTAKMFFVESSNEEADKIKCKPSPLIPNNNLIKVDSV
Uniprot No.

Target Background

Function
Melatonin receptor type 1A (Mtnr1a) is a high-affinity receptor for melatonin. It is believed to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is regulated by pertussis toxin-sensitive G proteins that inhibit adenylate cyclase activity.
Gene References Into Functions
  1. Melatonin MT1 and MT2 receptors interact with dopamine transporter (DAT) in the striatum. PMID: 30043140
  2. Our data demonstrate that the activation of MT1 signaling at night modulates insulin sensitivity during the day via the regulation of the PI3K transcription and activity. PMID: 29247541
  3. Knockdown of melatonin receptor leads to interference in the normal physiological function of the ovary by enhancing follicular apoptosis, inhibiting proliferation, and influencing hormonal signaling. PMID: 29097083
  4. The present study shows that MT1 receptor deficiency alters the temporal feeding pattern but not the amount of food ingested, and melatonin signaling mediated through the MT1 receptor stimulates Pro-Opiomelanocortin expression in both the ARC and PD of mice. PMID: 27490331
  5. Taken together, these data suggest that melatonin-MT1 receptor complexes represent a potential target for the treatment of glioma. PMID: 29408377
  6. Ecto-5'-nucleotidase mRNA levels were found to be diminished in both MT1 and MT1/2 knockout mice. PMID: 26917036
  7. The removal of MT1R or MT2R in mice abolished the daily rhythm in blood glucose levels, but produced small effects on the rhythmic expression patterns of clock genes within skeletal muscle, liver, and adipose tissue. PMID: 26824606
  8. We have shown that melatonin receptors are expressed in embryonic salivary glands, specifically during salivary gland branching morphogenesis. Melatonin inhibits branching morphogenesis independently of both apoptosis and cell proliferation. PMID: 25876057
  9. MT1 melatonin receptors are involved in neural pathways modulating diurnal rhythms of spontaneous behavior in the homecage as well as pathways regulating depressive and anxiolytic-like behaviors. PMID: 25200199
  10. These data demonstrate that melatonin MT1 receptor knockout mice recapitulate several behavioral and neurobiological circadian changes. PMID: 25638817
  11. The effect of miR-29b on endothelial permeability and apoptosis is mediated through the down-regulation of melatonin receptor 1. PMID: 25131924
  12. There is an increased proinflammatory status of mice deficient in both membrane-bound melatonin receptors reflected by altered activation of MAPK cascades and transcriptional activation of proinflammatory mediators. PMID: 25352055
  13. This study demonstrated that METH-induced CPP is dependent on time of day and the presence of the MT1 receptor, suggesting a role for melatonin in METH-induced reward. PMID: 24813704
  14. Heteromeric MT1/MT2 melatonin receptors modulate photoreceptor function. PMID: 24106342
  15. These data suggest that melatonin, by acting on MT1 receptors, affects NeuroD expression in the gastrointestinal tract and thus might contribute to circadian regulation in metabolic functions. PMID: 23700151
  16. MT1R signaling and BMP-4 actions are mutually augmented, leading to fine-tuning of ACTH production by corticotrope cells. PMID: 23701823
  17. Deletion of the MT1 and MT2 melatonin receptors decreases the development and expression of methamphetamine-induced locomotor sensitization during the light period. PMID: 22672659
  18. Melatonin does not exhibit its potentiation sleeping time in mice through melatonin 3 receptor. PMID: 21166245
  19. Molecular behavior of MT1 and MT2 receptor. PMID: 22202844
  20. Decreased viability of retinal ganglion cells observed in Mtnr1a knock-out mice may be a consequence of increased intraocular pressure. Intraocular pressure and melatonin signaling should be considered as risk factors for glaucoma. PMID: 21362461
  21. Immunohistochemical analysis revealed that during tooth development Mel1aR was expressed in secretory ameloblasts, the cells of the stratum intermedium and stellate reticulum, external dental epithelial cells, odontoblasts, and dental sac cells. PMID: 20372918
  22. Investigated the role of the melatonin/melatonin receptor system on clock gene expression using a model of primary neuronal cultures prepared from the striatum. PMID: 18798788
  23. MT1 receptor is a major transducer of melatonin's actions in the breast, suppressing mammary gland development and mediating the anticancer actions of melatonin through multiple pathways. PMID: 20050373
  24. Taken together, MT1 receptor signaling may be important for normal brain and behavioral function. PMID: 16459197
  25. MT1 receptor transcripts were localized in photoreceptor cells and in some inner retinal neurons. PMID: 19706469

Show More

Hide All

Database Links

KEGG: mmu:17773

STRING: 10090.ENSMUSP00000069872

UniGene: Mm.5133

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key pharmacological differences between recombinant mouse MT1 and MT2 receptors?

CompoundMT1 AffinityMT2 AffinitySelectivity Ratio (MT2/MT1)
MelatoninHighHigh~1
2-IodomelatoninVery HighHigh~1
4P-PDOTLowHigh~100
LuzindoleModerateHigh~11

How can I validate the expression of recombinant mouse MT1 receptors in my experimental system?

Validating MT1 receptor expression requires a multi-faceted approach. The development of monoclonal antibodies has significantly improved detection capabilities. The first recommendation is to employ both molecular and protein-based detection methods:

  • RT-PCR and Real-time qPCR: Use validated primer pairs targeting the Mtnr1a gene. RNA samples should include appropriate controls, with PCR reactions performed using 400 ng RNA for MT1 (40 cycles) . Negative controls must include no-RT controls to ensure amplicons result only from reversely transcribed mRNA.

  • Western blotting: Use specific antibodies such as the rabbit polyclonal anti-MT1 antibody directed against the third intracellular loop (residues 223-236: (C)RVKPDNKPKLKPQD) of mouse MT1 . Always include a blocking peptide control to confirm specificity.

  • Immunofluorescence microscopy: Apply antibodies at 1:50 dilution in blocking buffer with overnight incubation at 4°C. Secondary antibodies (e.g., goat anti-rabbit-IgG conjugated to AlexaFluor 647) should be applied at 1:2,000 dilution .

  • Functional assays: Measure MT1-mediated inhibition of forskolin-stimulated cAMP accumulation, which produces concentration-dependent responses with pIC50 values around 9.5-9.7 .

What are the recommended experimental conditions for studying recombinant mouse MT1 receptor signaling?

For robust experimental design when studying mouse MT1 receptor signaling:

  • Cell culture systems: Chinese hamster ovary (CHO) cells provide a reliable expression system. Maintain stable transfectants in appropriate selection medium.

  • Binding assays: Use [³H]-melatonin for receptor binding studies with concentrations ranging from 10 pM to 10 nM. For mouse MT1, expect pKD values around 9.89 with Bmax values of approximately 1.20 pmol/mg protein .

  • Signaling assessment:

    • For G protein-mediated signaling, forskolin-stimulated cAMP assays remain the gold standard

    • Pretreat cells with pertussis toxin (100-200 ng/ml, 16-24h) to confirm Gi/Go involvement

    • Measure ERK1/2 and PI3K/AKT pathway activation as additional readouts

  • Pharmacological tools:

    • Selective antagonist: Use 4P-PDOT at concentrations >100-fold higher than required for MT2 antagonism

    • Non-selective antagonist: Luzindole can be used at concentrations yielding a pA2 value of 5.75

How can heteromerization between mouse MT1 and MT2 receptors be detected in experimental systems?

Heteromerization between MT1 and MT2 receptors represents an important regulatory mechanism. To detect and validate MT1/MT2 heteromer formation:

  • Co-immunoprecipitation: Use specific antibodies against each receptor subtype to pull down protein complexes. Recent studies employed this approach to demonstrate MT1/MT2 heteromer formation in mouse retina .

  • Proximity Ligation Assay (PLA): This technique allows visualization of protein interactions in situ with high specificity. PLA has successfully demonstrated MT1/MT2 heteromerization in photoreceptor cells .

  • Bioluminescence/Fluorescence Resonance Energy Transfer (BRET/FRET): These approaches require tagging receptors with appropriate donor/acceptor pairs.

  • Functional studies: MT1/MT2 heteromers display unique pharmacological properties. For example, while low doses of the MT2-selective agonist IIK7 fail to mimic melatonin effects, higher doses activating both MT2 and MT1 protomers fully recapitulate melatonin's actions .

  • Heteromer-selective compounds: The antagonists 4P-PDOT and luzindole show activity against MT1/MT2 heteromers that differs from their action on homomers.

Experimental validation should include knockout controls (MT1-/- or MT2-/- mice) or dominant negative mutants to confirm heteromer-specific effects.

What approaches can resolve contradictory findings regarding MT1 receptor distribution in mouse tissues?

Resolving contradictory findings regarding MT1 receptor distribution requires rigorous methodology:

  • Multiple detection techniques: Implement complementary approaches including in situ hybridization, RT-PCR, and immunohistochemistry. Recent studies demonstrated MT1 expression in mouse mesenteric artery smooth muscle but not in rat vessels using this multi-method approach .

  • Knockout controls: All detection methods should include tissues from MT1-/- mice as negative controls. This practice was instrumental in validating monoclonal antibody specificity in studies examining MT1 expression in retina, suprachiasmatic nuclei, and pituitary gland .

  • Quantitative expression analysis: Real-time qPCR provides quantitative comparison between tissues. When comparing MT1 gene expression, use the 2^-ΔΔCt method with appropriate housekeeping genes like β-actin (ACTB) .

  • Antibody validation: Address the historical challenge of unreliable antibodies by using extensively characterized monoclonal antibodies. Specificity should be confirmed through Western blot, immunoprecipitation, immunofluorescence, and proximity ligation assays .

  • Species differences: Note that antibody cross-reactivity varies significantly between species. For example, some monoclonal antibodies specific for mouse MT1 show no cross-reactivity with rat MT1 , potentially explaining some contradictory findings.

How do mutations in the mouse Mtnr1a gene affect receptor function and physiological outcomes?

Mutations in the mouse Mtnr1a gene produce complex phenotypes that reveal critical insights into receptor function:

  • Knockout models: Complete MT1 receptor deletion (MT1-/-) has demonstrated that:

    • MT1 mediates melatonin's inhibitory effects on suprachiasmatic nucleus (SCN) neuronal firing

    • MT1 is essential for rapid eye movement (REM) phase regulation during sleep

    • MT1 deletion affects glucose homeostasis, supporting its role in metabolic regulation

  • Point mutations and partial deletions: CRISPR/Cas9-mediated deletion mutations in the Mtnr1a gene revealed unexpected findings, including that heterozygous mutations can sometimes produce more severe phenotypes than homozygous deletions. In Xenopus tropicalis, heterozygous Mtnr1a mutations caused rod photoreceptor loss, while homozygous mutants were less affected .

  • Signaling consequences: Mutations can differentially impact various signaling pathways:

    • cAMP inhibition via Gi/Go proteins

    • ERK1/2 pathway activation

    • PI3K/AKT signaling

    • PLC-PKC pathway modulation

  • Tissue-specific effects: The consequence of Mtnr1a mutations varies by tissue. For example, in vascular tissues, MT1 receptor mutations can affect neurogenic contractions in mesenteric arteries through PVAT-dependent mechanisms .

  • Developmental timing: Some phenotypes of MT1 mutations are age-dependent. Rod photoreceptor degeneration in Mtnr1a mutants was evident during development but less obvious after metamorphosis .

What are the optimal conditions for expressing functional recombinant mouse MT1 receptors in heterologous systems?

For optimal expression of functional recombinant mouse MT1 receptors:

  • Expression systems:

    • CHO cells demonstrate reliable expression and appropriate post-translational modifications

    • HEK293 cells are suitable for transient expression studies

    • Avoid systems with endogenous melatonin receptor expression

  • Vector selection:

    • Use mammalian expression vectors with strong promoters (CMV, EF1α)

    • Consider vectors with inducible expression systems for receptors that might exhibit constitutive activity

    • Include appropriate tags (His, FLAG) that don't interfere with receptor function

  • Transfection optimization:

    • For stable expression, linearize plasmid DNA before transfection

    • Optimize transfection reagent:DNA ratios (typically 3:1 for lipid-based transfection)

    • Allow 48-72 hours post-transfection before testing expression

  • Selection strategy:

    • For stable lines, use appropriate antibiotic selection (G418 at 400-800 μg/ml)

    • Consider fluorescence-activated cell sorting for homogeneous populations

    • Test multiple clones to identify those with physiological expression levels

  • Expression validation:

    • Verify protein expression by Western blot

    • Confirm membrane localization through subcellular fractionation

    • Assess functionality through binding assays using [³H]-melatonin

How can I design experiments to differentiate between MT1 monomer, homodimer, and heterodimer signaling?

Designing experiments to distinguish between different MT1 receptor configurations requires sophisticated approaches:

  • Pharmacological differentiation:

    • MT1/MT2 heterodimers display distinct pharmacological profiles from monomers/homodimers

    • Use the MT2-selective agonist IIK7 at varying concentrations: low doses activate only MT2 protomers, while higher doses can activate both MT1 and MT2 in heteromeric complexes

    • MT1/MT2 heteromers are antagonized by 4P-PDOT and luzindole with distinct potencies

  • Biophysical approaches:

    • Implement BRET/FRET with differentially tagged receptors

    • For monomers vs. homodimers, use constructs with the same receptor but different tags

    • For heterodimers, tag MT1 and MT2 with compatible donor/acceptor pairs

  • Genetic manipulation:

    • Express dominant negative mutants to disrupt specific receptor configurations

    • Use CRISPR/Cas9 to create cell lines lacking one receptor type

    • Implement controlled expression systems with titrated receptor ratios

  • Signaling readouts:

    • Different receptor configurations preferentially couple to distinct signaling pathways

    • Measure multiple pathways simultaneously (cAMP, Ca²⁺, ERK1/2, β-arrestin recruitment)

    • Compare signaling kinetics, as dimers may show altered activation/deactivation profiles

  • Spatial organization:

    • Use super-resolution microscopy to visualize receptor clustering

    • Implement single-particle tracking to assess mobility differences between configurations

    • Apply mathematical modeling to differentiate between configurations based on mobility data

What are the most reliable methods for quantifying recombinant mouse MT1 receptor expression levels?

Reliable quantification of recombinant mouse MT1 receptor expression requires complementary approaches:

  • Ligand binding assays:

    • Saturation binding with [³H]-melatonin remains the gold standard

    • Calculate Bmax values to determine receptor density (pmol/mg protein)

    • Expect Bmax values around 1.20 pmol/mg protein for MT1 receptors in CHO cells

    • Include non-specific binding controls using excess unlabeled melatonin (10 μM)

  • Western blot quantification:

    • Use validated antibodies against MT1 (e.g., rabbit polyclonal anti-MT1)

    • Include calibration curves with recombinant protein standards

    • Normalize to housekeeping proteins and total protein loading

    • Use fluorescent secondary antibodies for wider linear detection range

  • Flow cytometry:

    • Apply cell-surface labeling with non-permeabilized cells

    • Use fluorophore-conjugated antibodies or primary/secondary combinations

    • Include calibration beads with known antibody binding capacity

    • Express results as molecules of equivalent soluble fluorochrome (MESF)

  • RT-qPCR:

    • Implement absolute quantification with plasmid standards

    • Include multiple reference genes for normalization

    • Convert to copy number per cell using appropriate calculations

    • Note that mRNA levels may not directly correlate with protein expression

  • Mass spectrometry:

    • Apply targeted proteomics with isotope-labeled peptide standards

    • Focus on unique peptides from the MT1 sequence

    • Implement parallel reaction monitoring for improved sensitivity

    • Express results as fmol receptor per mg total protein

How can biased signaling at recombinant mouse MT1 receptors be assessed and exploited in experimental systems?

Biased signaling at MT1 receptors represents an exciting research frontier:

  • Multipathway profiling:

    • Systematically measure multiple signaling outputs including:

      • Gi/Go-mediated cAMP inhibition

      • ERK1/2 and PI3K/AKT pathway activation

      • β-arrestin recruitment

      • Receptor internalization kinetics

    • Calculate bias factors using operational models comparing pathway activation relative to a reference ligand (typically melatonin)

  • Biased ligand identification:

    • Screen compound libraries against different signaling pathways

    • Recent studies identified compound 37 as devoid of Gi signaling at MT1 while maintaining other activities

    • Test novel synthetic MT1 agonists for differential pathway activation

  • Pathway inhibitor toolkit:

    • Use pertussis toxin (100-200 ng/ml) to block Gi/Go signaling

    • Apply PD98059 or U0126 to inhibit MEK/ERK pathway

    • Implement PI3K inhibitors like wortmannin or LY294002

    • Use β-arrestin siRNA knockdown or CRISPR knockout

  • Structural determinants:

    • Implement site-directed mutagenesis of key residues in transmembrane domains and intracellular loops

    • Focus particularly on the third intracellular loop (residues 223-236), which contains important G protein coupling determinants

    • Create receptor chimeras with domains from MT1 and MT2 to identify regions critical for pathway selectivity

  • Physiological correlates:

    • Correlate biased signaling profiles with specific physiological outcomes

    • Design in vivo studies to test whether biased MT1 agonists produce subset of melatonin effects

What role do post-translational modifications play in regulating recombinant mouse MT1 receptor function?

Post-translational modifications of MT1 receptors represent an under-explored regulatory mechanism:

  • Phosphorylation sites:

    • Multiple serine and threonine residues in the C-terminal tail and third intracellular loop can undergo phosphorylation

    • Use phosphosite-specific antibodies or mass spectrometry to identify phosphorylation patterns

    • Implement site-directed mutagenesis (S/T→A) to prevent phosphorylation at specific sites

    • Assess how phosphorylation affects G protein coupling, arrestin recruitment, and internalization

  • Glycosylation:

    • N-linked glycosylation occurs at asparagine residues in the N-terminal domain

    • Treat cells with tunicamycin to inhibit N-glycosylation or use PNGase F enzymatically

    • Create glycosylation-deficient mutants to assess importance for trafficking and ligand binding

    • Determine if species differences in glycosylation contribute to pharmacological differences

  • Palmitoylation:

    • Cysteine residues in the C-terminal tail can undergo palmitoylation

    • Use click chemistry with alkyne-tagged palmitate analogs to detect palmitoylation

    • Apply 2-bromopalmitate to inhibit palmitoylation

    • Assess consequences for receptor localization in membrane microdomains

  • Ubiquitination:

    • Lysine residues can be modified with ubiquitin, targeting receptors for degradation

    • Use proteasome inhibitors (MG132) to block degradation

    • Immunoprecipitate receptors and probe for ubiquitin to assess modification

    • Determine if chronic agonist exposure leads to increased ubiquitination

  • Methodological approach:

    • Combined immunoprecipitation/mass spectrometry to identify all modifications

    • Create a comprehensive map of MT1 modifications under basal and stimulated conditions

    • Determine tissue-specific modification patterns using recombinant expression in different cell types

How can advances in structural biology be applied to the study of recombinant mouse MT1 receptors?

Recent structural biology advances offer unprecedented opportunities for MT1 receptor research:

  • Cryo-electron microscopy (cryo-EM):

    • Generate stable MT1 receptor complexes with G proteins or other signaling partners

    • Implement antibody fragments or nanobodies to stabilize specific conformations

    • Determine structural differences between active and inactive states

    • Recent XFEL studies of human MT1/MT2 receptors provide templates for mouse receptor modeling

  • Molecular dynamics simulations:

    • Build models of mouse MT1 receptors based on human structures

    • Simulate ligand binding and conformational changes during activation

    • Identify species-specific differences in binding pocket architecture

    • Calculate binding energies for selective ligands to explain pharmacological profiles

  • Structure-based virtual screening:

    • Use high-resolution structures to screen for novel MT1-selective ligands

    • Focus on unique features of the mouse MT1 binding pocket

    • Recent virtual screening of MT structures yielded 10 new agonist chemotypes with sub-micromolar potency

    • Implement flexible docking to account for induced-fit effects

  • Structural basis of biased signaling:

    • Compare structures of MT1 with different ligands to identify conformational signatures of bias

    • Focus on intracellular loop conformations that preferentially engage specific signaling partners

    • Design MT1 mutants to test structure-based hypotheses about signaling bias

  • Heterodimer structures:

    • Model MT1/MT2 heterodimer interfaces

    • Identify key residues for heterodimer formation

    • Design peptides or small molecules to disrupt or stabilize specific heteromeric interfaces

    • Compare signaling from monomeric, homodimeric, and heterodimeric structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.