Recombinant Mouse Melatonin-related receptor (Gpr50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr50; Melatonin-related receptor; G protein-coupled receptor 50; H9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGPTKAVPTPFGCIGCKLPKPDYPPALIIFMFCAMVITVVVDLIGNSMVILAVTKNKKLR NSGNIFVASLSVADMLVAIYPYPLMLYAMSVGGWDLSQLQCQMVGLVTGLSVVGSIFNIT AIAINRYCYICHSLQYKRIFSLRNTCIYLVVTWVMTVLAVLPNMYIGTIEYDPRTYTCIF NYVNNPAFTVTIVCIHFVLPLIIVGYCYTKIWIKVLAARDPAGQNPDNQFAEVRNFLTMF VIFLLFAVCWCPVNVLTVLVAVIPKEMAGKIPNWLYLAAYCIAYFNSCLNAIIYGILNES FRREYWTIFHAMRHPILFISHLISDIRETWETRALTRARVRARDQVREQERARACVAVEG TPRNVRNVLLPGDASAPHSDRASVRPKPQTRSTSVYRKPASIHHKSISGHPKSASVYPKP ASSVHCKPASVHFKPASVHFKGDSVYFKGDTVHYRAASKLVTSHRISAGPSTSHPTSMAG YIKSGTSHPATTTVDYLEPATTSHSVLTAVDLPEVSASHCLEMTSTGHLRADISASVLPS VPFELAATPPDTTAIPIASGDYRKVVLIDDDSDDSDCSDEMAV
Uniprot No.

Target Background

Function
GPR50, also known as the melatonin-related receptor, is a G protein-coupled receptor (GPCR) that does not bind melatonin. It is a member of the rhodopsin-like GPCR family and shares structural similarities with other GPCRs involved in various signaling pathways. While its exact function is still under investigation, GPR50 has been implicated in several biological processes, including neuronal differentiation, energy metabolism, and immune regulation.
Gene References Into Functions
  1. GPR50 serves as a TbetaRI co-receptor, potentially impacting cancer development. PMID: 29572483
  2. GPR50 promotes neuronal differentiation through its intracellular domain. PMID: 25689717
  3. A connection exists between GPR50 expression and neurotransmitter signaling during brain development. PMID: 22860215
  4. Studies indicate that Txnip expression is elevated in the hypothalamus of Gpr50-/- mice during torpor. PMID: 23584857
  5. GPR50 plays a role in adaptive thermogenesis in mice. PMID: 22197240
  6. An expanded distribution of GPR50 protein has been observed in the brain. PMID: 22512326
  7. Data demonstrate that GPR50 enhances TIP60-coactiavtion of glucocorticoid receptor (GR) signalling. PMID: 21858214
  8. Antibodies have been used to investigate GPR50 expression in the mouse, rat, and human hypothalamus. GPR50 immunoreactivity was observed in dorsomedial hypothalamic (DMH) cells and in cells of the ependymal layer of the third ventricle of the hypothalamus. PMID: 20210849
  9. GPR50 is an essential regulator of energy metabolism. PMID: 17957037

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR50 and how does it relate to melatonin receptors?

GPR50 is an orphan G-protein-coupled receptor (GPCR) exclusively found in mammals and located on the X chromosome (Xq28). Despite sharing 45% sequence homology with melatonin receptors MT1 and MT2, GPR50 cannot bind melatonin and remains an orphan receptor with no identified endogenous ligands. The receptor is primarily expressed in the pituitary and hypothalamus, suggesting involvement in neuroendocrine functions . Research methodology to establish receptor relationships typically involves sequence alignment analysis, phylogenetic studies, and structural modeling to understand evolutionary relationships between GPR50 and other receptors in the melatonin receptor family.

How is GPR50 expression regulated in different tissues?

GPR50 shows high expression levels in the pituitary and hypothalamus, suggesting its involvement in neuroendocrine regulation. Expression studies require careful tissue collection protocols and precise quantification methods such as RT-PCR, which has been successfully employed to detect GPR50 transcripts in human cerebral microvascular endothelial cells (hCMEC/D3) . For protein expression analysis, researchers commonly use Western blotting with specific antibodies, which can detect both monomeric (~70-90 kDa) and dimeric (~140-180 kDa) forms of GPR50. Immunohistochemistry can complement these approaches for spatial resolution of expression patterns across different brain regions, with particular attention to hypothalamic nuclei involved in energy homeostasis.

What experimental models are available for studying GPR50 function?

Several experimental models have been developed for GPR50 research:

  • Cell lines: HEK 293 cells expressing GPR50 (HEK-GPR50) serve as a controlled system for studying GPR50 interactions and signaling .

  • Knockout mice: GPR50 knockout models have been created through insertion of a lacZ gene into the coding sequence, providing valuable insights into metabolic phenotypes .

  • Human tissue analysis: Post-mortem brain tissue studies help correlate GPR50 variants with psychiatric conditions.

  • siRNA approaches: GPR50-selective siRNA duplexes enable targeted downregulation of GPR50 expression to study its function in various cell types .

When designing experiments, researchers should consider both homologous recombination and CRISPR-Cas9 approaches for generating knockout models, with careful phenotyping protocols that address both central and peripheral effects of GPR50 manipulation.

How does GPR50 interact with melatonin receptors at the molecular level?

GPR50 forms constitutive heterodimers with both MT1 and MT2 melatonin receptors in intact cells, as demonstrated through multiple complementary techniques. Bioluminescence resonance energy transfer (BRET) experiments show energy transfer between GPR50-Rluc and MT1-YFP or MT2-YFP at levels comparable to MT1 homodimers, confirming physical interaction in living cells . Co-immunoprecipitation experiments with differentially tagged receptors further validate these interactions, where immunoprecipitation of GPR50-YFP allows detection of co-precipitated Flag-GPR50 as both monomers (~70 kDa) and SDS-resistant dimers (~140 kDa) .

The interaction specificity has been confirmed by the absence of significant BRET signals between GPR50-Rluc and control GPCRs like β2-adrenergic receptor and CCR5. Importantly, melatonin stimulation does not alter these heterodimeric interactions, suggesting they are constitutive rather than ligand-regulated. These molecular interaction studies require careful optimization of protein expression levels and appropriate controls to distinguish specific interactions from random collisions in the membrane.

What functional consequences result from GPR50 heterodimerization with melatonin receptors?

The heterodimerization of GPR50 with melatonin receptors produces receptor-specific functional effects:

  • MT1 receptor: GPR50 significantly inhibits MT1 function by:

    • Reducing 125I-MLT binding sites by more than 50% without altering binding affinity (Kd values: 290±64 pM vs 335±56 pM)

    • Decreasing the maximal functional response to both melatonin (50% reduction) and synthetic agonist S20098 (45% reduction) without significantly affecting EC50 values

    • Abolishing G protein coupling to the MT1 protomer engaged in the heterodimer

  • MT2 receptor: Unlike MT1, GPR50 heterodimerization with MT2 does not significantly alter MT2 function or ligand binding properties .

This differential regulation suggests GPR50 serves as a specific negative regulator of MT1-mediated melatonin signaling, with potential physiological implications for circadian rhythm regulation and other melatonin-dependent processes. Experimental approaches to study these functional consequences should include both binding assays and downstream signaling readouts such as G protein activation, cAMP production, or calcium mobilization.

What is the role of the GPR50 C-terminal domain in receptor function?

The C-terminal tail of GPR50 plays a crucial regulatory role in its inhibitory effect on MT1 function. Deletion of this large C-terminal domain suppresses GPR50's inhibitory effect on MT1 without affecting the physical heterodimerization between the receptors . This suggests the C-terminal domain regulates the interaction of regulatory proteins with MT1 rather than the direct receptor-receptor association.

Experimental approaches to study this domain include:

  • Creation of truncation mutants with varying C-terminal lengths

  • Site-directed mutagenesis of key residues within the C-terminal domain

  • Protein-protein interaction studies to identify C-terminal binding partners

  • Functional assays comparing wild-type GPR50 versus C-terminal deletion mutants

These studies are critical for understanding the molecular mechanisms by which GPR50 regulates melatonin signaling and may identify potential targets for therapeutic intervention.

How does GPR50 influence energy homeostasis and metabolism?

GPR50 knockout mice exhibit significant metabolic phenotypes, suggesting this receptor plays an important role in energy homeostasis. These mice show:

  • Reduced body weight compared to wild-type littermates by 10 weeks of age when maintained on normal chow

  • Partial resistance to diet-induced weight gain when fed a hypercaloric, high-fat diet

These findings indicate GPR50 may function as a regulator of energy metabolism and body weight homeostasis. Additionally, certain GPR50 variants in humans are associated with altered lipid profiles, including higher triglyceride levels and lower HDL-cholesterol levels .

Research methodologies for investigating these metabolic effects should include:

  • Comprehensive metabolic phenotyping (energy expenditure, food intake, activity levels)

  • Glucose and insulin tolerance testing

  • Analysis of fat distribution and adipose tissue function

  • Measurement of metabolic hormones and inflammatory markers

  • Assessment of hypothalamic signaling pathways involved in feeding behavior

What evidence links GPR50 to psychiatric disorders?

Multiple lines of evidence suggest GPR50 involvement in psychiatric conditions:

  • Genetic association studies have identified GPR50 variants associated with psychiatric disorders:

    • A deletion mutant of GPR50 shows genetic association with bipolar affective disorder and major depressive disorder

    • A Scottish case-control study found female-specific associations between GPR50 variants and three psychiatric conditions: bipolar disorder, major depressive disorder, and schizophrenia

  • The ESPRIT study in elderly populations provided weak but present support for GPR50 involvement in late-life depression, specifically in:

    • Female subjects

    • Cases with more severe forms of depression

  • The rs13440581 polymorphism was associated with both depression and antidepressant use in women

Research approaches should include:

  • Case-control genetic association studies with adequate sample sizes

  • Sex-stratified analyses due to X-linked nature of GPR50

  • Consideration of depression subtypes and comorbidities

  • Functional characterization of risk variants in cellular and animal models

What binding assays are most effective for studying GPR50 and its interactions?

  • Radioligand binding assays using 125I-MLT (iodomelatonin) to study the effect of GPR50 on melatonin receptor binding:

    • Saturation binding experiments to determine Bmax and Kd values

    • Competition binding assays with various melatonin receptor ligands

    • Binding studies in the presence vs. absence of GPR50 expression

  • Protein-protein interaction assays:

    • Co-immunoprecipitation with differentially tagged receptors

    • BRET assays for live-cell interaction studies

    • Fluorescence resonance energy transfer (FRET) for spatial resolution of interactions

When designing binding experiments, researchers should control for:

  • Receptor expression levels using luminescence or fluorescence measurements

  • Non-specific binding with appropriate controls

  • Potential confounding factors such as temperature, pH, and buffer composition

  • Use of both membrane preparations and intact cells to capture physiological context

How can GPR50 knockout models be best utilized for functional studies?

GPR50 knockout mice provide valuable tools for understanding receptor function in vivo. Effective utilization includes:

  • Comprehensive phenotyping approaches:

    • Metabolic parameters (body weight, food intake, energy expenditure)

    • Behavioral assessments (particularly for psychiatric phenotypes)

    • Endocrine measurements (stress hormones, reproductive hormones)

    • Challenge tests (diet manipulation, stress paradigms)

  • Tissue-specific and time-controlled knockout strategies:

    • Conditional knockout using Cre-loxP systems for temporal control

    • Brain region-specific deletion to distinguish central vs. peripheral effects

  • Molecular and cellular analysis:

    • Transcriptomic and proteomic profiling of relevant tissues

    • Signaling pathway activation assessment

    • Histological examination for developmental or structural changes

  • Rescue experiments:

    • Re-expression of wild-type GPR50 in knockout background

    • Introduction of specific variants to assess their functional impact

When using knockout models, researchers should consider potential developmental compensation mechanisms and use complementary approaches like acute knockdown with siRNA to distinguish between developmental and acute effects of GPR50 absence .

What are the most effective methods for identifying potential GPR50 ligands?

As an orphan receptor, identifying GPR50's endogenous ligand(s) remains a significant research priority. Effective approaches include:

  • High-throughput screening methods:

    • Cell-based assays measuring downstream signaling (calcium mobilization, cAMP production)

    • Receptor internalization assays

    • Conformational biosensors to detect receptor activation

  • Computational approaches:

    • Pharmacophore modeling based on structural similarity to melatonin receptors

    • Virtual screening of compound libraries

    • Molecular docking studies

  • Deorphanization strategies:

    • Tissue extract fractionation and bioassay

    • Targeted candidate approach based on known interacting partners

    • Reverse pharmacology using phenotype-based screening

  • Proteomic approaches:

    • Pull-down assays with GPR50 as bait

    • Mass spectrometry identification of binding partners

    • Cross-linking studies to capture transient interactions

These approaches should be complemented with validation studies using knockout models and careful controls to confirm specificity of potential ligand interactions.

How do sex differences influence GPR50 research outcomes?

Given that GPR50 is X-linked, sex differences are particularly important considerations in research design and interpretation:

  • Genetic association studies have identified female-specific associations between GPR50 variants and psychiatric disorders:

    • The ESPRIT study found that associations between GPR50 variants and depression were detectable only in women

    • The rs13440581 polymorphism showed sex-specific associations with both depression and antidepressant use

  • Experimental design considerations:

    • All genetic analyses should be performed separately in males and females due to GPR50's X-linked nature

    • Hardy-Weinberg equilibrium should be examined by comparing observed and expected genotype frequencies in women only

    • General genetic models should be employed for women to retain the three distinct genotype classes

  • Hormonal influences:

    • Interactions between GPR50 and reproductive hormones should be investigated

    • Estrogen may regulate GPR50 expression or function

    • Melatonin-related signaling shows sexual dimorphism

Research approaches should include balanced sex representation, stratified analyses by sex, and consideration of hormonal status in female subjects, particularly for studies involving psychiatric phenotypes where sex differences in prevalence are well-documented.

What are the challenges in developing therapeutic approaches targeting GPR50?

Developing therapeutic interventions targeting GPR50 presents several unique challenges:

  • Orphan receptor status:

    • Lack of identified endogenous ligand(s) complicates drug development

    • Unknown physiological agonists or antagonists limit pharmacological targeting

    • Uncertainty about optimal activation/inhibition state for therapeutic benefit

  • Complex protein-protein interactions:

    • GPR50's effects through heterodimerization with melatonin receptors suggests alternative targeting strategies

    • The regulatory role of the C-terminal domain presents a potential target for peptide-based therapeutics

    • Disrupting specific protein-protein interactions may be more effective than direct receptor targeting

  • Sex-specific considerations:

    • X-linked nature and sex-specific associations require sex-tailored therapeutic approaches

    • Potential interactions with sex hormones may affect drug efficacy

  • Tissue-specific expression:

    • Predominantly central expression (hypothalamus, pituitary) creates blood-brain barrier penetration challenges

    • Potential for unwanted side effects due to widespread GPCR signaling pathways

Research directions should focus on structural characterization of GPR50, particularly its C-terminal domain, development of biased ligands that affect specific signaling pathways, and exploration of allosteric modulators that could influence heterodimerization with melatonin receptors.

How can contradictory findings in GPR50 research be reconciled?

The field of GPR50 research contains several apparent contradictions that require careful consideration:

  • Genetic association inconsistencies:

    • While some studies report associations between GPR50 variants and psychiatric disorders, subsequent studies in children and adults have reported mixed findings

    • Reconciliation requires:

      • Meta-analysis of existing studies

      • Larger sample sizes with greater statistical power

      • Consideration of population stratification

      • Analysis of specific subtypes of psychiatric disorders

  • Methodological differences:

    • Various experimental systems (cell lines, animal models, human samples) may yield different results

    • Standardization of:

      • Receptor expression levels in heterologous systems

      • Genetic background in animal models

      • Clinical phenotyping in human studies

  • Complex regulatory mechanisms:

    • GPR50's dual roles in both melatonin signaling and metabolic regulation may appear contradictory

    • Integration of findings requires systems biology approaches:

      • Pathway analysis incorporating multiple signaling networks

      • Temporal dynamics of receptor interactions

      • Tissue-specific regulatory mechanisms

Future research should emphasize replication studies, standardized methodologies, and integration of findings across multiple experimental paradigms to build a coherent understanding of GPR50's physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.