Recombinant Mouse Membralin (ORF61)

Shipped with Ice Packs
In Stock

Description

Functional and Pathological Roles

Membralin’s primary role involves mitigating ER stress by facilitating ERAD. Key findings include:

Interaction with ERAD Machinery

Membralin binds to Erlin2, an ER membrane protein enriched in lipid rafts, to regulate the degradation of misfolded ER membrane proteins (e.g., CD3-δ) . Its absence slows substrate clearance, exacerbating ER stress.

Motor Neuron Survival

Membralin-deficient (ORF61 knockout) mice exhibit:

  • Postnatal motor neuron loss by P5–6, leading to paralysis and death.

  • Selective vulnerability of lower motor neurons (limbs, diaphragm) .

  • Rescue by transgenic Membralin expression, confirming its neuroprotective role .

PhenotypeMechanistic InsightSource
Motor neuron degenerationER stress accumulation in neurons
Attenuated ERAD efficiencySlower degradation of CD3-δ in MEFs
Transgene rescueNeural expression restores motor function

Research Applications and Disease Models

Membralin KO mice serve as a model for early-onset motor neuron diseases, such as distal hereditary motor neuropathy (HMN). Key applications include:

  • ER stress modulation: Testing inhibitors (e.g., salubrinal) to delay disease progression .

  • Neuroprotective mechanisms: Investigating Membralin’s role in lipid raft organization and ERAD regulation .

Challenges and Future Directions

Despite its critical role, gaps remain in Membralin research:

  • Production limitations: Recombinant Membralin is not widely available, hindering structural studies.

  • Therapeutic targets: Erlin2 or ER stress pathways may offer intervention points for motor neuron diseases .

  • Human relevance: C19orf6 (human ortholog) remains understudied, though conserved across species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem259; ORF61; Membralin; Transmembrane protein 259
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-574
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem259
Target Protein Sequence
MSEHAAAPGPGPNGGGGGGAAPVRGPRGPNLNPNPLINVRDRLFHALFFKMAVTYSRLFP PAFRRLFEFFVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDRWPREGVLRVEVRHNSSR APVILQFCDGGLGGLELEPGGLELEEEELTVEMFTNSSIKFELDIEPKVFKPQSGADALN DSQDFPFPETPAKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTLDPTRDQCFGD RFSRLLLDEFLGYDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFV IMVIFTLSVSMLLRYSHHQIFVFIVDLLQMLEMNMAIAFPAAPLLTVILALVGMEAIMSE FFNDTTTAFYIILTVWLADQYDAICCHTNTSKRHWLRFFYLYHFAFYAYHYRFNGQYSSL ALVTSWLFIQHSMIYFFHHYELPAILQQIRIQEMLLQTPPLGPGTPTALPDDLNNNSGSP ATPDPSPPLALGPSSSPAPTGGASGPGSLGAGASVSGSDLGWVAETAAIISDASFLSGLS ASLLERRPTAPSTPDSSRPDPGVPLEDAPAPAGS
Uniprot No.

Target Background

Function
Membralin may play a role in the ERAD pathway, which is essential for clearing misfolded proteins in the endoplasmic reticulum (ER). It promotes the survival of motor neurons, likely by protecting against ER stress.
Gene References Into Functions
  1. Research indicates that membralin is a component of the Endoplasmic-reticulum-associated degradation (ERAD) pathway and plays a crucial role in Alzheimer's disease pathogenesis. PMID: 29133892
  2. Membralin is critical for motor neuron survival, suggesting a novel mechanism for early-onset motor neuron disease. PMID: 25977983
  3. This research focuses on the genomic organization and expression of membralin. PMID: 12638133
Database Links
Protein Families
Membralin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, spinal cord, lung, liver and kidney.

Q&A

What is Mouse Membralin (ORF61) and what are its key structural characteristics?

Membralin is a highly conserved protein encoded by the orf61 gene in mice (equivalent to c19orf6 in humans). It was named "membralin" because it was predicted to be a membrane protein . Structurally, membralin lacks known protein domains, suggesting it may represent a novel class of proteins . The protein contains multiple transmembrane segments that anchor it to the endoplasmic reticulum membrane.

Methodologically, researchers have characterized membralin through:

  • cDNA cloning from mouse tissues

  • Sequence analysis revealing the absence of known protein domains

  • Subcellular localization studies confirming its presence in the ER membrane

  • Identification of its interaction with the ERAD component Erlin2

The full-length mouse membralin protein contains approximately 620 amino acids, with the C-terminal region (last 89 amino acids) being particularly important for its function, as truncation of this region in knockout models leads to severe phenotypes .

What are the standard methods for producing recombinant mouse membralin?

Producing recombinant mouse membralin typically involves:

  • Cloning strategy: The full-length mouse membralin cDNA is amplified from mouse tissue (typically brain) using RT-PCR with specific primers designed from the known sequence of orf61 .

  • Expression system selection: For full-length membrane proteins like membralin, mammalian expression systems (such as HEK293 cells) are preferred over bacterial systems to ensure proper folding and post-translational modifications.

  • Vector construction: The membralin cDNA is inserted into appropriate expression vectors, often with tags (such as GFP or GST) for visualization and purification. For example, in Yang et al.'s study, GFP-membralin constructs were used in transgenic mice, enabling visualization of membralin expression in spinal cord .

  • Transfection and expression: The constructs are transfected into host cells, and expression conditions are optimized (temperature, induction time, etc.).

  • Purification: Depending on the tag used, appropriate purification methods (affinity chromatography, size exclusion, etc.) are applied.

For research applications requiring transgenic expression, membralin can be expressed under neural-specific promoters, as demonstrated in rescue experiments where transgenic expression of membralin in the nervous system rescued membralin knockout mice .

How do you validate the functionality of recombinant membralin in experimental settings?

Functional validation of recombinant membralin can be performed through multiple complementary approaches:

In vitro assays:

  • ERAD substrate degradation assay: Since membralin is involved in ERAD, measuring the degradation rate of known ERAD substrates in cells with or without membralin expression can validate functionality .

  • Protein-protein interaction assays: Confirming interaction with known partners like Erlin2 using co-immunoprecipitation or pull-down assays.

  • ER stress response assays: Measuring changes in ER stress markers in response to membralin expression.

In vivo validation:

  • Rescue experiments: The most definitive validation comes from rescue experiments in membralin-deficient models. Neural expression of a membralin transgene completely rescues the fatal phenotype in membralin knockout mice, confirming functional activity .

  • Histological analysis: Examining motor neuron survival in spinal cord sections of membralin-deficient mice with or without recombinant membralin expression.

Quantitative measurements:

  • Assessment of ER stress markers (BiP/GRP78, CHOP, XBP1 splicing)

  • Quantification of motor neuron numbers in the ventral horn of spinal cord

  • Survival analysis of membralin knockout mice with or without transgene expression

What is the current understanding of membralin's role in motor neuron survival?

Membralin plays a critical role in motor neuron survival through its involvement in ER homeostasis and stress response pathways:

Key mechanisms:

  • ERAD pathway regulation: Membralin interacts with Erlin2, a protein important for ER-associated protein degradation. This interaction facilitates the removal of misfolded proteins from the ER, preventing ER stress buildup .

  • ER stress mitigation: Membralin deficiency leads to increased basal ER stress and renders neurons more vulnerable to ER stress-inducing agents .

  • Selective vulnerability of motor neurons: Lower motor neurons, including those innervating limbs, intercostal muscles, and diaphragm, show particular vulnerability to membralin deficiency .

Experimental evidence:

  • Membralin knockout mice display severe motor neuron degeneration (~50% motor neuron loss) and die around postnatal day 5-6 .

  • The survival of these mice can be completely rescued by neural-specific expression of a membralin transgene, confirming the neuron-specific requirement for membralin .

  • The degradation rate of ERAD substrates is significantly reduced in cells lacking membralin, supporting its role in protein quality control .

This understanding provides mechanistic insight into early-onset motor neuron diseases and suggests that membralin-mediated pathways may offer potential therapeutic targets.

What are the molecular mechanisms through which membralin regulates ER-associated protein degradation (ERAD)?

The molecular mechanisms of membralin's role in ERAD involve multiple protein interactions and regulatory pathways:

Interaction with ERAD machinery:

  • Membralin directly interacts with Erlin2, an ER membrane protein located in lipid rafts that plays a crucial role in ERAD .

  • This interaction appears to be essential for efficient removal of misfolded proteins from the ER.

ERAD substrate processing:

  • Cells lacking membralin show attenuated degradation rates of ERAD substrates, suggesting membralin is required for efficient substrate processing .

  • The mechanism likely involves recognition of misfolded proteins, their extraction from the ER membrane, and targeting to the proteasome.

Signaling pathway modulation:

  • Membralin may function as an adaptor protein that connects components of the ERAD machinery.

  • Unlike some ERAD components (such as viral proteins like HSV ICP0), membralin does not appear to directly degrade proteins like PML, suggesting a regulatory rather than directly proteolytic role .

Structural requirements:

  • The C-terminal region of membralin is particularly important, as truncation of this region in knockout models leads to loss of function .

  • These mechanisms collectively contribute to maintaining ER homeostasis, which is particularly crucial in highly active cells like motor neurons.

How do membralin mutations or deficiencies specifically affect motor neurons compared to other cell types?

Motor neurons exhibit selective vulnerability to membralin deficiency through several mechanisms:

Differential vulnerability analysis:

Cell TypeVulnerability to Membralin DeficiencyProposed Mechanism
Lower motor neuronsSevere (50% loss in KO mice)High protein synthesis demands; limited ER stress capacity
Upper motor neuronsModerateDifferent ER stress response pathways
Sensory neuronsMinimalLower dependence on ERAD pathways
Glial cellsMinimalMore robust ER stress response mechanisms
Muscle cellsIndirect effects onlyNo intrinsic requirement for membralin

Mechanistic explanations:

  • High protein synthesis burden: Motor neurons have high rates of protein synthesis to maintain their extensive processes, creating greater demand for efficient ERAD systems .

  • Limited ER stress capacity: Motor neurons appear to have a limited capacity to handle ER stress compared to other cell types, making them more dependent on optimal ERAD function .

  • Selective innervation defects: In membralin-deficient mice, motor neurons innervating limbs, intercostal muscles, and the diaphragm are particularly affected, suggesting regional specificity in vulnerability .

  • Rescue specificity: The complete rescue of membralin knockout phenotypes by neural expression of membralin confirms the primary neuronal requirement rather than effects in other tissues .

This selective vulnerability parallels findings in other motor neuron diseases like ALS, suggesting common pathways of motor neuron degeneration involving ER stress.

What are the experimental challenges in studying the interaction between membralin and Erlin2, and how can they be overcome?

Studying the membralin-Erlin2 interaction presents several technical challenges:

Key challenges and solutions:

As demonstrated in published research, GST pull-down assays have been successfully employed to study SUMO-binding properties of related proteins , and similar approaches could be adapted for membralin-Erlin2 interaction studies.

How does membralin expression change during development, and what are its implications for neurodegenerative disease models?

The developmental regulation of membralin expression provides important insights into its role in neurodegeneration:

Developmental expression pattern:

  • Membralin expression is tightly regulated during embryonic and postnatal development, with critical expression required shortly after birth .

  • The severe phenotype and death of membralin knockout mice by postnatal day 5-6 indicates an essential role during early postnatal development .

Temporal requirements:

  • The timing of motor neuron loss in membralin-deficient mice (~50% loss preceding death around P5) suggests a critical window during which membralin function is essential .

  • This coincides with important developmental processes including synapse maturation and myelination.

Implications for disease modeling:

Disease ModelRelevance of MembralinResearch Applications
Early-onset motor neuron diseasesDirect - membralin deficiency causes motor neuron deathModels for spinal muscular atrophy (SMA), infantile-onset ALS
Adult-onset ALSIndirect - may involve progressive failure of membralin-dependent pathwaysStudy of age-dependent changes in ER stress tolerance
ER stress-related neurodegenerationMechanistic - demonstrates critical role of ERAD in neuron survivalTherapeutic target identification for various neurodegenerative conditions

Therapeutic implications:

  • The timing of intervention appears critical, as demonstrated by rescue experiments with neural expression of membralin transgenes .

  • ER stress inhibitors (such as salubrinal, guanabenz, and sphin1) have shown promise in delaying disease onset and prolonging survival in related models, suggesting potential therapeutic approaches .

  • Understanding the developmental regulation of membralin may help identify critical windows for therapeutic intervention in related neurodegenerative diseases.

What are the most effective experimental designs for evaluating membralin function in different subcellular compartments?

Comprehensive assessment of membralin function across subcellular compartments requires multi-faceted experimental approaches:

Compartment-specific analysis strategies:

  • ER membrane function:

    • Approach: Use split-GFP or FRET-based reporters positioned at the ER membrane to monitor membralin interactions with ERAD components.

    • Readout: Changes in ERAD efficiency measured by degradation kinetics of model substrates (e.g., CD3δ, TCRα).

    • Controls: Compare wild-type membralin with C-terminal truncation mutants known to be functionally deficient .

  • ER-cytosol interface:

    • Approach: Employ proximity labeling techniques (BioID, APEX) with membralin as the bait protein.

    • Readout: Mass spectrometry identification of labeled proteins from different cellular fractions.

    • Analysis: Bioinformatic clustering of identified proteins by function and compartment.

  • Lipid raft association:

    • Approach: Use detergent-resistant membrane fractionation followed by western blotting.

    • Readout: Co-fractionation of membralin with known lipid raft markers (including Erlin2).

    • Validation: Cholesterol depletion to disrupt rafts and assess impact on membralin localization and function.

  • Nucleus-ER communication:

    • Approach: ChIP-seq or CUT&RUN to identify genomic regions affected by membralin deficiency.

    • Readout: Changes in ER stress response gene expression.

    • Integration: Correlate with UPR activation markers and protein degradation rates.

Temporal resolution:

  • Use optogenetic tools to acutely disrupt or activate membralin function in specific compartments.

  • Employ live-cell imaging with fluorescent timers to track protein degradation in real-time.

These approaches can provide comprehensive understanding of how membralin functions across different cellular compartments, particularly at the ER membrane where it interacts with Erlin2 to facilitate ERAD processes .

What is the relationship between membralin function and SUMO-interacting motifs (SIMs), and how does this impact experimental design?

The relationship between membralin and SUMO-interacting motifs represents an interesting area for investigation, though there appears to be some ambiguity in the current literature:

Current understanding and clarification:

Experimental approaches to investigate potential SUMO interactions:

  • Sequence analysis and prediction:

    • Bioinformatic analysis of mouse membralin sequence for potential SIM motifs (consensus V/I-x-V/I-V/I or similar hydrophobic patterns).

    • Comparison with other ERAD components known to utilize SUMO-dependent mechanisms.

  • Biochemical interaction studies:

    • GST pull-down assays with GST-SUMO1/2/3 fusion proteins to test for direct interaction with membralin .

    • Mutagenesis of potential SIM sequences followed by binding assays to determine specificity.

  • Functional impact assessment:

    • Creation of SIM mutant versions of membralin (if SIMs are identified).

    • Comparison of ERAD efficiency between wild-type and SIM-mutant membralin.

    • Analysis of protein interactions, particularly with SUMOylated forms of ERAD components.

Experimental design table:

Experimental QuestionMethodologyControlsExpected Outcome if SIMs are Functional
Does membralin bind to SUMO?GST-SUMO pulldownGST alone; Known SIM-containing proteinSpecific binding to SUMO but not GST alone
Are SIMs required for membralin function?ERAD substrate degradation assay with WT vs SIM mutantsMembralin KO cells; Rescue with WTReduced ERAD efficiency with SIM mutants
Do SIMs affect membralin localization?Immunofluorescence of WT vs SIM mutantsCo-staining with ER markersAltered distribution of SIM mutants
Are SIMs involved in stress response?ER stress induction in cells with WT vs SIM mutantsUntreated controlsDifferential stress response with SIM mutants

While the direct relevance of SUMO interaction to membralin remains to be established, these approaches provide a framework for investigation that could reveal additional regulatory mechanisms for this important ERAD component.

What are the most promising directions for therapeutic applications targeting membralin pathways in motor neuron diseases?

Based on our current understanding of membralin function, several therapeutic directions show promise for treating motor neuron diseases:

ER stress modulation approaches:

  • Small molecule inhibitors of ER stress have shown efficacy in related models. Specifically, salubrinal, guanabenz, and sphin1 have been demonstrated to delay disease onset and prolong survival in motor neuron disease models .

  • These compounds work by reducing the load of unfolded proteins, suggesting a viable therapeutic strategy for diseases involving membralin dysfunction.

Targeted enhancement of ERAD pathways:

  • Direct enhancement of membralin expression or function could potentially rescue defects in protein quality control.

  • Gene therapy approaches expressing membralin in affected neurons might be particularly effective, as demonstrated by the complete rescue of knockout mice through neural-specific membralin expression .

Combinatorial approaches:

  • Targeting multiple points in the ER stress response pathway simultaneously may provide synergistic benefits.

  • For example, combining ERAD enhancement with mitigation of downstream effects of ER stress.

Preventative strategies:

  • Since motor neurons show selective vulnerability to ER stress, early intervention before symptom onset could be particularly effective.

  • Biomarkers of early ER dysfunction could help identify at-risk individuals for preventative therapy.

Pre-clinical validation metrics:

  • Rescue of motor neuron survival in cellular and animal models

  • Normalization of ER stress markers

  • Improvement in ERAD substrate clearance

  • Functional recovery in motor performance tests

The critical involvement of membralin in motor neuron survival makes this pathway particularly attractive for therapeutic development in conditions like early-onset motor neuron diseases, and potentially for other neurodegenerative conditions involving ER stress .

How can researchers effectively design experimental controls when studying membralin in different model systems?

Designing appropriate controls is crucial for rigorous investigation of membralin function across model systems:

Cellular models - Control design strategy:

Experimental GroupAppropriate ControlsRationale
Membralin knockdown/knockoutScrambled siRNA; Empty vectorControls for non-specific effects of nucleic acid introduction
Membralin overexpressionTag-only expression; Inactive mutant (e.g., C-terminal truncation)Controls for effects of protein expression burden and tag interference
ER stress inductionDose-response curves; Time-course analysisControls for differential sensitivity across cell types
Rescue experimentsExpression-matched controls; Species-specific variantsControls for expression level effects and species differences

Animal models - Control hierarchy:

  • Genetic background controls:

    • Use littermate controls whenever possible to minimize genetic background differences .

    • For transgenic rescue experiments, compare membrane-deficient mice with and without the transgene from the same litters .

  • Temporal controls:

    • Age-matched controls are essential, particularly given the rapid progression of the membralin knockout phenotype.

    • Time-course experiments to establish disease progression relative to changing membralin levels.

  • Tissue-specific controls:

    • Compare affected tissues (motor neurons) with unaffected tissues from the same animals.

    • Use tissue-specific knockout/expression systems with appropriate Cre-negative controls.

  • Functional validation controls:

    • Include known motor neuron disease models (e.g., SOD1 mutants) as reference points.

    • Use pharmacological ER stress inducers and inhibitors to calibrate the system.

Specific examples from literature:

  • In membralin studies, transgenic expression of GFP-membralin provided both rescue and visualization capabilities, with appropriate controls for transgene expression .

  • Heterozygous mice served as important controls, demonstrating that partial reduction of membralin is not sufficient to cause motor defects .

  • Gene trapping strategies provided complementary approaches to confirm phenotypes observed in knockout models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.