Recombinant Mouse Membrane-associated progesterone receptor component 2 (Pgrmc2)

Shipped with Ice Packs
In Stock

Description

Introduction

Progesterone receptor membrane component 2 (PGRMC2) is a membrane-bound progesterone receptor that is crucial for fast-signaling responses . PGRMC2 plays roles in various physiological processes, including female reproduction, heart function, and adipocyte function .

Gene Information

PGRMC2, also known as progesterone receptor membrane component 2, has been identified as a gene targeted by miR-3687 .

Expression and Localization

Pgrmc2 mRNA is present in the immature rat ovary . PGRMC2 is found in oocytes and ovarian surface epithelial, interstitial, thecal, granulosa, and luteal cells . In rat ovaries, Pgrmc2 mRNA levels are highest prior to gonadotropin treatment and decrease by approximately 40% 48 hours after eCG (equine Chorionic Gonadotropin) treatment, and remain at that level after hCG (human Chorionic Gonadotropin) treatment .

Role in Ovarian Function

PGRMC2 affects granulosa cell mitosis at two specific stages of the cell cycle . It regulates the progression from the G0 into the G1 stage and appears to localize to the mitotic spindle, promoting the final stages of mitosis . PGRMC2 is required for progesterone to slow the rate of granulosa cell mitosis and apoptosis, supporting a role in ovarian follicle development .

In granulosa cells of young women with diminished ovarian reserve, Pgrmc2 expression is elevated .

Role in Endometrium

In macaques, PGRMC1 and PGR are elevated during the proliferative phases of the menstrual cycle, declining to nearly undetectable levels during the late secretory phase, while PGRMC2 levels are lowest during the proliferative phases and increase markedly during the secretory phases . Strong staining for PGRMC2 is localized to the luminal and glandular epithelia during the secretory phases . Macaques with endometriosis exhibit reduced levels of PGRMC2 transcript and altered intracellular staining patterns for the PGRMC2 protein compared to disease-free animals . This suggests that membrane-bound PGRMC2 may mediate the non-genomic effects of progesterone on the glandular epithelia during the secretory phase, and reduced levels may be associated with progesterone insensitivity in the endometrium of primates with endometriosis .

Role in Cardiac Function

PGRMC2 regulates cardiac pressure-volume relationships and mediates steroid hormone signaling to maintain calcium homeostasis, which ensures proper heart contraction and function under stress . During hypoxia, metabolic acidosis was observed in PGRMC2 KO (knockout) mice but not wild-type mice, as indicated by blood pH . The absence of PGRMC2 significantly exacerbated cardiac fibrosis and dilation in both left and right ventricles under hypoxic stress, which impeded electrical propagation and repolarization, manifesting as abnormal J-waves on ECG in PGRMC2 KO mice . Cardiac remodeling processes observed in KO mice also led to decreased exercise tolerance and systolic blood pressure (SBP) .

Blood Gas Analyses in Wild-Type (WT) and PGRMC2 Knockout (KO) Mice Under Normoxic or Hypoxic Conditions

Blood GasWT NormoxicKO NormoxicWT HypoxicKO Hypoxic
pHp<0.0001p<0.0001p<0.0001p<0.0001
pCO2
BEecfp<0.0001p<0.0001p<0.0001p<0.0001
HCO3p<0.0001p<0.0001p<0.0001p<0.0001
Hemoglobin (Hgb)p<0.0001p<0.0001
Hematocrit (Hct)p<0.0001p<0.0001

Statistical significance between different groups is indicated in the graph with asterisk (); data are presented as mean values ± SEM.*

Role in Adipocyte Function

PGRMC2 functions as an intracellular heme chaperone critical for adipocyte function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Pgrmc2; Membrane-associated progesterone receptor component 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pgrmc2
Target Protein Sequence
MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLL GAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGK VFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREW EMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD
Uniprot No.

Target Background

Function
Membrane-associated progesterone receptor component 2 (Pgrmc2) is essential for maintaining uterine histoarchitecture and normal female reproductive lifespan. It may function as a universal non-classical progesterone receptor in the uterus. Pgrmc2 also acts as an intracellular heme chaperone, delivering labile or signaling heme to the nucleus. Furthermore, it plays a role in adipocyte function and systemic glucose homeostasis. In brown adipose tissue, with its high heme demand, nuclear delivery of labile heme regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1.
Gene References Into Functions
  1. Essential for maintaining uterine histoarchitecture and normal female reproductive lifespan. PMID: 28005395
Database Links
Protein Families
Cytochrome b5 family, MAPR subfamily
Subcellular Location
Membrane; Single-pass membrane protein. Nucleus envelope. Endoplasmic reticulum.
Tissue Specificity
Expressed in brown adipose tissue, white adipose tissue, liver, heart, skeletal muscle, brain and adrenal gland.

Q&A

What is Pgrmc2 and what protein family does it belong to?

Pgrmc2 (Progesterone Receptor Membrane Component 2) is a member of the Membrane Associated Progesterone Receptor (MAPR) family that includes four proteins: PGRMC1, PGRMC2, Neudesin, and Neuferricin. These proteins share a cytochrome b5-like domain (PFAM00173) and bind heme . Unlike Neudesin and Neuferricin which are soluble and secreted, PGRMC2 possesses a single predicted transmembrane domain, similar to PGRMC1 .

The protein contains a cytochrome b5-like heme/steroid binding domain, although direct evidence for steroid hormone binding is less conclusive than for heme binding. Structurally, Pgrmc2 is designed to function in heme trafficking with medium-low affinity for heme (Kd ~1.4 x 10^-6 M for ferric heme and 5.3 x 10^-6 M for ferrous heme), suggesting it binds heme reversibly rather than serving as a terminal storage protein .

How is Pgrmc2 different from Pgrmc1?

While both Pgrmc1 and Pgrmc2 are heme-binding proteins in the MAPR family with transmembrane domains, they display distinct subcellular localizations and functions:

FeaturePgrmc1Pgrmc2
Primary localizationMitochondria-associatedEndoplasmic reticulum-associated
Position in heme traffickingUpstream (initial acceptor)Downstream (secondary carrier)
Known interactionsCytochrome P450 enzymesRev-Erbα, BACH1
Heme bindingBinds hemeBinds and transfers heme

Evidence suggests a sequential relationship where mitochondria-bound PGRMC1 transfers heme to ER-bound PGRMC2, which subsequently delivers heme to proteins in the ER and nucleus, including heme-responsive transcription factors .

How can researchers generate Pgrmc2 knockout mice?

The generation of conditional Pgrmc2-ablated mice employs Cre-Lox recombination technology through the following methodology:

  • Prepare a targeting vector by recombineering, retrieving a 13.6-kb section of the Pgrmc2 genomic sequence containing exons 2 and 3 plus 4 kb of 3′-downstream sequences from bacterial artificial chromosome RP23-2C23 into pPL253 by gap repair .

  • Insert a 5′ LoxP site into intron 1 approximately 1.3 kb upstream of exon 2, followed by insertion of Frt-PGFneo-Frt-LoxP into the 3′-downstream sequence approximately 0.9 kb downstream of exon 3 .

  • Linearize the vector by NotI digestion, purify, and electroporate into mouse embryonic stem cells derived from F1(129Sv/C57BL6j) blastocysts .

  • Culture cells with G418 (150 μg/mL) and ganciclovir (2 μM), then select drug-resistant colonies and screen by nested long-range PCR .

  • Use targeted ES cells to generate chimeric mice by aggregation with CD1 morula, then breed chimeric males with ROSA26-Flpe mice to remove the PGKneo cassette, generating Pgrmc2 floxed (Pgrmc2 fl/fl) founder mice .

  • Cross these mice with tissue-specific Cre recombinase-expressing mice (e.g., Pgr-cre) to achieve conditional knockout in tissues of interest .

What assays can determine Pgrmc2's heme binding and transfer capabilities?

Several experimental approaches can assess Pgrmc2's interaction with heme:

  • In-gel heme transfer assay: Incubate apo-Rev-Erbα with PGRMC2, separate the mixture by native electrophoresis, and stain for both heme and protein. Observation of heme staining in the Rev-Erbα band indicates successful heme transfer from PGRMC2 to apo-Rev-Erbα .

  • Heme binding affinity measurements: Spectroscopic analyses to determine Kd values for both ferric and ferrous heme forms (1.4 x 10^-6 M and 5.3 x 10^-6 M respectively for Pgrmc2) .

  • Subcellular labile heme assessment: Transfect cells with GFP:hemoprotein peroxidase fusion reporters targeted to specific compartments (mitochondria, ER, cytosol, nuclei). The activity of these reporters directly correlates with the availability of labile heme in each compartment, allowing visualization of heme trafficking defects when Pgrmc2 is manipulated .

  • Mutational analysis: Generate heme-binding mutants (e.g., PGRMC2 3xM) to demonstrate the necessity of the heme-binding capability for Pgrmc2's functions in heme transfer .

How does Pgrmc2 facilitate intracellular heme trafficking?

PGRMC2 functions as a critical intracellular heme chaperone in a sophisticated trafficking pathway that allows heme to move from its synthesis site to target proteins throughout the cell. This process involves:

  • Heme synthesis completion in mitochondria, where ferrochelatase (FECH) adds iron to protoporphyrin IX .

  • Initial transfer of newly synthesized heme from mitochondria to mitochondria-bound PGRMC1 .

  • Subsequent transfer from PGRMC1 to ER-bound PGRMC2, acting as an intermediate carrier .

  • PGRMC2-mediated delivery of heme to target proteins in the ER and nuclear compartments .

This pathway is evidenced by experiments showing that dual PGRMC1/2 knockdown had no additional effect beyond PGRMC2 knockdown alone on nuclear heme levels, suggesting PGRMC2 acts downstream of PGRMC1 in trafficking endogenously-synthesized heme . The medium-low affinity of PGRMC2 for heme (Kd values in the micromolar range) supports its role in transient binding and transfer rather than terminal storage .

What is the relationship between Pgrmc2 and nuclear transcription factors?

PGRMC2 plays a crucial role in regulating nuclear transcription factors through heme delivery:

  • PGRMC2 delivers labile heme to the nucleus, directly affecting heme-responsive transcriptional repressors including Rev-Erbα and BACH1 .

  • When PGRMC2 is deleted in tissues like brown fat, labile heme in the nucleus decreases, resulting in increased stability of these transcriptional repressors .

  • The altered transcriptional landscape leads to extensive changes in gene expression, particularly affecting mitochondrial function genes .

  • Direct heme transfer from PGRMC2 to apo-Rev-Erbα has been demonstrated in vitro, with wild-type PGRMC2 (but not heme-binding mutants) capable of transferring heme to Rev-Erbα .

This transcriptional regulation mechanism explains many of the physiological defects observed in Pgrmc2-deficient models, as these heme-responsive transcription factors control genes involved in cellular metabolism and mitochondrial function.

How does Pgrmc2 deficiency affect adipose tissue function?

Deletion of Pgrmc2 in brown adipose tissue (BAT) results in profound metabolic dysfunction:

PhenotypeObservation in PGRMC2-null BATMechanism
Thermogenic capacitySevere impairment; mice rapidly become hypothermic at 4°CReduced mitochondrial function and UCP1 levels
Response to β-adrenergic stimulationSignificantly blunted oxygen consumption increase after CL316,243 administrationIntact transcriptional response but defective mitochondrial machinery
Mitochondrial functionSeverely reduced respiratory capacityDecreased ETC proteins and UCP1 levels
Heme content~60% reduction in total hemeReduced heme biosynthesis substrates and altered expression of heme synthesis enzymes

These defects are specifically related to PGRMC2's heme-trafficking function, as introduction of wild-type human PGRMC2 into mouse PGRMC2-null brown adipocytes restores mitochondrial bioenergetics and UCP1 levels, while expression of a PGRMC2 heme-binding mutant does not . The thermogenic defect is independent of norepinephrine levels, as the transcriptional response to adrenergic stimulation remains intact despite the functional impairment .

What role does Pgrmc2 play in reproductive physiology?

Conditional ablation of Pgrmc2 in the female reproductive system results in significant fertility defects:

Similar reproductive defects have been observed in both Pgrmc2-null and Pgrmc1/2 double knockout models, suggesting overlapping functions of these proteins in reproductive physiology . The specific mechanisms by which Pgrmc2 supports embryo development and implantation require further investigation but may involve heme-dependent processes in the uterine environment.

Does Pgrmc2 have potential as a therapeutic target in metabolic disease?

Evidence suggests PGRMC2 may be a promising therapeutic target for metabolic disorders:

  • Obese-diabetic mice treated with a small-molecule PGRMC2 activator showed substantial improvement of diabetic features, suggesting pharmacological enhancement of PGRMC2 function could ameliorate metabolic dysfunction .

  • The critical role of PGRMC2 in adipocyte function, particularly in brown adipose tissue, positions it as a potential target for enhancing energy expenditure and improving metabolic health .

  • When fed a high-fat diet, adipose-specific PGRMC2-null mice showed greater metabolic deterioration, implying that boosting PGRMC2 function might protect against diet-induced metabolic disorders .

The specific mechanisms by which PGRMC2 activation improves metabolic parameters require further investigation but likely involve enhanced mitochondrial function and heme-dependent metabolic processes in adipose tissue. Development of selective PGRMC2 modulators could represent a novel approach to treating obesity and diabetes.

What are the most pressing unanswered questions about Pgrmc2 function?

Several critical questions remain regarding Pgrmc2 function:

  • Structural determinants of heme binding and transfer: While Pgrmc2 is known to bind and transfer heme, the precise structural mechanisms and protein-protein interfaces involved in this process remain poorly characterized .

  • Tissue-specific functions: Pgrmc2 is expressed in multiple tissues, but its function has been primarily studied in adipose tissue and reproductive organs. Its roles in other tissues, particularly the brain and liver, warrant further investigation .

  • Relationship to progesterone signaling: Despite its name suggesting a role in progesterone signaling, the connection between Pgrmc2's heme-binding function and potential involvement in steroid hormone pathways remains unclear .

  • Therapeutic targeting specificity: Development of selective Pgrmc2 modulators will require better understanding of structural and functional differences between Pgrmc1 and Pgrmc2 to enable isoform-specific targeting .

  • Interaction with cellular stress responses: The connection between Pgrmc2-mediated heme trafficking and cellular responses to various stressors, including oxidative stress, represents an important area for future research .

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and physiological studies to fully elucidate the mechanisms and significance of Pgrmc2 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.