Recombinant Mouse Membrane cofactor protein (Cd46)

Shipped with Ice Packs
In Stock

Description

Overview and Functional Role

CD46, also known as Membrane Cofactor Protein (MCP), is a type I transmembrane glycoprotein that regulates complement activation by serving as a cofactor for Factor I-mediated cleavage of C3b and C4b . It is expressed on nucleated cells and plays dual roles:

  • Complement Regulation: Prevents excessive complement-mediated damage by inactivating C3b/C4b, thereby protecting host cells .

  • Pathogen Receptor: Acts as an entry receptor for measles virus (MV), human herpesvirus 6 (HHV-6), and bacterial pathogens like Streptococcus pyogenes .

  • Immune Modulation: Influences T-cell activation, costimulatory signaling, and regulatory T-cell (Treg) differentiation .

The recombinant mouse CD46 is engineered to study these functions in murine models, bypassing the limited endogenous expression of CD46 in wild-type mice (primarily restricted to testis) .

Production and Purity

Recombinant mouse CD46 is produced via bacterial expression systems with high precision:

  • Purity: >90% as confirmed by SDS-PAGE under reducing/non-reducing conditions .

  • Formulation: Available as liquid (Tris/PBS buffer with 5–50% glycerol) or lyophilized powder (6% trehalose) .

  • Storage: Stable at -20°C/-80°C for up to 12 months (lyophilized) or 6 months (liquid) .

Research Applications

The recombinant protein is employed in diverse experimental contexts:

Pathogen Interaction Studies

PathogenMechanismSource
Measles Virus (MV)Recombinant CD46 binds MV glycoproteins, enabling fusion assays
HHV-6Mediates viral entry via extracellular domain interactions
Streptococcus pyogenesM-protein binds CD46 CCPs 3–4, promoting bacterial adhesion and apoptosis

Immune Regulation

  • T-Cell Modulation: CD46 costimulates CD4+ T-cells, driving Th1 responses and subsequent Treg differentiation via IL-2/IL-10 signaling .

  • γδ T-Cell Suppression: Reduces IFN-γ/TNF-α production, contributing to immune tolerance .

Reproductive Biology

  • Sperm-Oocyte Fusion: CD46 disruption in mice accelerates acrosome reaction, increasing male fertility .

  • Transgenic Models: Human CD46-expressing mice mimic human isoform patterns (e.g., kidney, salivary gland) .

Key Research Findings

Study FocusFindingsSource
Complement RegulationRecombinant CD46 binds C4b with ED₅₀ of 2–12 μg/mL, mimicking native function
T-Cell SignalingCYT-2 isoform (23 aa) undergoes src kinase-dependent phosphorylation
Pathogen-Host InteractionsHHV-6 binding induces HERV-Env expression, linking to autoimmune diseases

Challenges and Considerations

  • Limited Native Expression: Wild-type mice express CD46 mainly in testis, necessitating transgenic models for systemic studies .

  • Partial Domain Coverage: Recombinant proteins exclude transmembrane/cytoplasmic regions, restricting signaling pathway analysis .

  • Species-Specific Roles: Human CD46 isoforms differ from mouse Crry (a homolog), complicating cross-species extrapolation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cd46; McpMembrane cofactor protein; CD antigen CD46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-365
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAWIIALIVITSIVGVFILCLIVLRCFEHRKKTNVSAAR
Uniprot No.

Target Background

Function
May be involved in sperm-oocyte fusion during fertilization.
Gene References Into Functions
  • Changes in CD46 expression may alter VEGF levels and contribute to age-related macular degeneration pathogenesis. PMID: 26161984
  • CD46 expression in the mouse eye suggests a protective role against laser-induced choroidal neovascularization. PMID: 25019227
  • Fusion is mediated by the interaction between viral glycoproteins (on infected cells) and CD46 (on glial targets), also observed with cells expressing recombinant MV glycoproteins. PMID: 15920733
  • CD46 isoforms serve as receptors for human herpesvirus 6 and measles virus. PMID: 12171934
  • Disruption of mouse CD46 accelerates spontaneous acrosome reactions in sperm, enhancing male fertility. PMID: 12640142
  • CD46 functions as a receptor for human herpesvirus 6 entry into target cells. PMID: 12724329
Database Links
Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Note=Inner acrosomal membrane of spermatozoa.; [Isoform 2]: Secreted.
Tissue Specificity
Present only in testis (at protein level).

Q&A

What is CD46 and how does mouse CD46 differ from human CD46?

CD46, also known as Membrane Cofactor Protein (MCP), functions as a cofactor for the Factor I-mediated inactivation of complement components C3b and C4b. The most striking difference between mouse and human CD46 is their expression pattern. While human CD46 is widely expressed in virtually all nucleated cells, mouse CD46 expression is largely restricted to the testis . This tissue-specific restriction indicates a specialized role in reproductive biology rather than systemic complement regulation . In mice, a related protein called Crry performs the complement regulatory functions that CD46 serves in humans . This fundamental species difference is critical to consider when designing experiments and interpreting results involving mouse models of human disease processes where CD46 plays a significant role .

What are the key structural components of mouse CD46 protein?

Mouse CD46, like its human counterpart, is a type I transmembrane protein. The protein contains short consensus repeats (SCRs) in its extracellular domain that harbor the C3b and C4b binding sites . The extracellular domain is followed by a Ser/Thr/Pro-enriched region, a transmembrane domain, and a cytoplasmic domain . Although structurally similar to human CD46, the mouse protein exhibits approximately 50% amino acid sequence identity within the extracellular domain compared to human CD46 . This structural homology allows mouse CD46 to maintain its specific functions in complement regulation within the testis while explaining some of the functional differences observed between species.

Why are transgenic CD46 mouse models important for research?

Transgenic mouse models expressing human CD46 have become invaluable research tools for several reasons. First, because native mouse CD46 expression is restricted to the testis, these transgenic models enable researchers to study the broader systemic functions of CD46 in a controlled in vivo environment . Second, since CD46 serves as a receptor for multiple human pathogens (including measles virus, human herpesvirus 6, and various adenoviruses), these mice provide essential platforms for studying host-pathogen interactions that would otherwise be impossible in normal mice . Third, transgenic CD46 mice have proven useful for investigating the role of CD46 in T cell regulation and autoimmunity, allowing for the modeling of diseases like multiple sclerosis where CD46-mediated Tr1 differentiation is defective . The tissue-specific expression patterns in these transgenic models closely mimic those observed in humans, making them particularly relevant for translational research .

What expression systems are most effective for producing recombinant mouse CD46?

When producing recombinant mouse CD46, mammalian expression systems generally yield the most biologically active protein due to their capacity for proper post-translational modifications. Chinese Hamster Ovary (CHO) cells and Human Embryonic Kidney (HEK293) cells are preferred expression systems because they can generate properly folded CD46 with appropriate glycosylation patterns essential for functional activity . Bacterial expression systems, while cost-effective, often fail to produce properly folded CD46 with native-like activity due to the absence of appropriate post-translational processing machinery. For research applications requiring chimeric proteins, such as CD46-Fc fusion proteins, the addition of a human IgG1 Fc region (Pro100-Lys330) can improve stability and enable easier purification through protein A/G affinity chromatography . Expression vectors should include appropriate signal sequences to ensure proper trafficking and membrane insertion if a membrane-bound form is desired.

How should recombinant mouse CD46 be reconstituted and stored to maintain optimal activity?

Recombinant mouse CD46 proteins, particularly CD46-Fc chimeras, are typically supplied in lyophilized form. For optimal reconstitution, proteins should be dissolved in sterile PBS at a concentration of approximately 500 μg/mL, as recommended for similar recombinant proteins . After reconstitution, the solution should be gently mixed rather than vortexed to prevent protein denaturation. For storage, it is crucial to avoid repeated freeze-thaw cycles that can significantly degrade protein quality and activity . Aliquoting the reconstituted protein and storing at -80°C is recommended for long-term preservation, while short-term storage (1-2 weeks) can be maintained at 4°C. For carrier-free preparations intended for cell culture applications, the addition of 0.1% BSA can help stabilize the protein without interfering with downstream applications. Prior to experimental use, functional validation through complement regulatory assays or binding studies should be performed to confirm biological activity .

What analytical methods are most appropriate for characterizing recombinant mouse CD46?

For comprehensive characterization of recombinant mouse CD46, a multi-method approach is recommended. SDS-PAGE analysis under both reducing and non-reducing conditions can verify proper molecular weight and disulfide bond formation, with mouse CD46-Fc chimera proteins typically appearing as bands between 88-98 kDa under reducing conditions and 160-190 kDa under non-reducing conditions . Western blotting using specific anti-CD46 antibodies confirms identity and can also reveal potential degradation products. For functional characterization, binding assays with C3b or C4b using techniques such as ELISA or surface plasmon resonance (SPR) are essential to confirm biological activity . Mass spectrometry can provide detailed information about post-translational modifications, especially glycosylation patterns that are crucial for CD46 function. Additionally, flow cytometry can assess the binding capacity of recombinant CD46 to complement components or pathogen proteins when studying receptor-ligand interactions . For researchers interested in isoform analysis, RT-PCR using isoform-specific primers can determine which splice variants are present in the recombinant preparation .

How can recombinant mouse CD46 be utilized in autoimmune disease research?

Recombinant mouse CD46 presents a valuable tool for investigating autoimmune conditions, particularly those where complement dysregulation or T cell dysfunction plays a pathogenic role. In multiple sclerosis (MS) research, recombinant CD46 can be used to study the defective CD46-mediated Tr1 cell differentiation observed in approximately 50% of MS patients . Experimental approaches include using the protein to stimulate T cells in vitro while monitoring IL-10 production, which is typically impaired in MS patients . In assay development, immobilized recombinant CD46 can serve as a capture molecule to quantify autoantibodies directed against CD46 in patient samples. For mechanistic studies, recombinant CD46 can be employed to compete with cell-surface CD46 for pathogen binding or complement component interactions, helping elucidate the role of CD46 in disease pathogenesis . When combined with transgenic CD46 mouse models, researchers can perform in vivo studies to evaluate how CD46 modulates immune responses in autoimmune conditions like rheumatoid arthritis and asthma, where defects in CD46-mediated Tr1 differentiation have been reported .

What methodological approaches can resolve contradictory data regarding CD46 function in T cell regulation?

Contradictory findings regarding CD46's role in T cell regulation often stem from variations in experimental conditions, cell types, and activation states. To resolve such discrepancies, researchers should implement standardized protocols focusing on several key methodological aspects. First, clearly define the CD46 isoforms being studied, as different splice variants can exhibit distinct functions . When activating T cells through CD46, use consistent antibody clones and concentrations alongside appropriate co-stimulatory signals to ensure reproducible results. Time-course experiments are essential, as CD46's effects on T cell function are highly dynamic—initial activation may promote inflammatory responses, while prolonged engagement typically leads to regulatory phenotypes .

Comparative analysis using cells from multiple donors is crucial given the genetic variation in CD46 expression patterns, with approximately 65% of the human population predominantly expressing the upper BC isoform, 29% expressing both forms equally, and 6% predominantly expressing the lower C form . When studying enzymatic processing of CD46, specific inhibitors of metalloproteinases and gamma-secretase should be employed to dissect the contribution of CD46 shedding to its regulatory functions . Finally, simultaneous measurement of multiple cytokines (including IL-10, IFN-γ, and IL-2) provides a more comprehensive assessment of T cell phenotypes than focusing on a single readout .

How does CD46 processing affect its functions in different experimental systems?

CD46 processing is a critical regulatory mechanism that directly impacts its function across various experimental systems. The protein undergoes sequential proteolytic processing: first, the ectodomain is shed through cleavage by matrix metalloproteinases (MMPs), followed by cleavage of the intracytoplasmic tails by the presenilin-gamma secretase (P/γS) enzymatic complex . This processing regulates CD46 surface expression and generates intracellular fragments with distinct signaling functions. In T cell systems, CD46 processing is essential for proper cytokine production—particularly the regulatory cytokine IL-10—and appropriate termination of T cell responses .

To effectively study these processes experimentally, researchers should employ time-course analyses with specific inhibitors such as GM6001 (for MMPs) and DAPT (for γ-secretase). Western blotting techniques should target both the extracellular domain and cytoplasmic tails using domain-specific antibodies to track processing events . For advanced studies, researchers might consider using targeted mass spectrometry to identify precise cleavage sites and resulting fragments. Cell-type specific differences in CD46 processing should be systematically investigated, as processing kinetics vary significantly between epithelial cells and T cells . When designing experiments involving CD46 signaling, it's imperative to account for these processing events, as they fundamentally alter CD46's functional outcomes in different experimental contexts.

What are the key methodological challenges when translating findings between human and mouse CD46 studies?

Translating findings between human and mouse CD46 studies presents several methodological challenges due to fundamental species differences. The restricted expression of native mouse CD46 to testicular cells requires careful experimental design when studying systemic complement regulation . Researchers should be aware that in mice, the Crry protein functionally compensates for CD46 in most tissues, necessitating parallel analyses of both proteins when investigating complement regulation . When using transgenic human CD46 mice, it's essential to characterize the expression pattern of the transgene, as different mouse strains may exhibit varying levels of human CD46 expression in different tissues .

For in vitro studies, primary cells isolated from transgenic mice may not perfectly recapitulate human CD46 functions due to potential differences in signaling machinery and interaction partners . Flow cytometric analyses should include both species-specific antibodies to properly distinguish transgenic human CD46 from endogenous mouse CD46 or Crry. When studying pathogen interactions, researchers must account for potential differences in binding affinities between human and mouse CD46 . Additionally, the interpretation of T cell studies should consider that the CD46-mediated Tr1 differentiation pathway observed in humans may function differently in mice due to divergent co-stimulatory networks . These methodological considerations are essential for proper experimental design and accurate interpretation of cross-species studies involving CD46.

How do mouse models with transgenic human CD46 compare in splice variant expression and tissue distribution?

Transgenic mouse models expressing human CD46 have been developed using yeast artificial chromosome (YAC) clones containing the complete CD46 gene, allowing for comprehensive evaluation of splice variant expression and tissue distribution . Remarkably, these transgenic models closely mimic the human pattern of CD46 expression across tissues, with isoform expression profiles highly similar to those observed in humans . As shown in detailed analyses of three independent transgenic mouse strains (hCD46Ge, CD46-1, and CD46-2), the relative abundance of mRNA splice variants (predominantly BC1 and BC2 for most tissues) correlates strongly with protein isoform expression (predominantly upper band) across different tissues .

Western blot analysis of tissues from these transgenic models reveals the characteristic broad, two-band pattern typical of human CD46, with upper bands (59,000-68,000 Mr; BC1 and BC2 isoforms) and lower bands (51,000-58,000 Mr; C1 and C2 isoforms) . Importantly, the tissue-specific isoform expression in kidney, salivary gland, and brain parallels that observed in humans . While no differences in isoform pattern or distribution were detected among the three transgenic strains, expression levels varied according to the number of integrated gene copies . Unlike humans, these transgenic mice express relatively low levels of CD46 on erythrocytes, which aligns with the pattern observed in most other primates . These findings confirm that transgenic mouse models faithfully reproduce human CD46 expression patterns, making them valuable tools for studying tissue-specific functions of CD46 and its role in pathogen interactions.

What control conditions should be included when designing experiments with recombinant mouse CD46?

When designing experiments with recombinant mouse CD46, comprehensive controls are essential for result validation and interpretation. For binding assays, include both positive controls (known CD46 ligands such as C3b or C4b) and negative controls (irrelevant proteins of similar size/structure) . When using recombinant CD46-Fc chimeras, an isolated Fc fragment control is necessary to distinguish effects mediated by CD46 from those potentially caused by the Fc portion . For functional assays measuring complement regulation, compare the activity of recombinant mouse CD46 with that of human CD46 and/or mouse Crry to account for species-specific differences in regulatory potency .

In cell-based experiments, include both CD46-positive and CD46-negative cell populations, ideally using isogenic cell lines that differ only in CD46 expression . For T cell activation studies, parallel stimulation with various control antibodies (isotype controls, antibodies targeting other costimulatory molecules) helps discriminate CD46-specific effects from general activation phenomena . When studying CD46 processing, treatments with specific inhibitors of metalloproteinases (for ectodomain shedding) and gamma-secretase (for intracellular cleavage) should be accompanied by appropriate vehicle controls and, where possible, inactive structural analogs of the inhibitors . Time-course experiments are particularly important for CD46 studies, as its effects on cellular functions can vary dramatically over time, transitioning from pro-inflammatory to regulatory phases in T cell responses .

What is the optimal approach for studying CD46 interactions with complement components?

Studying CD46 interactions with complement components requires a multi-faceted approach combining biochemical, biophysical, and cellular techniques. For direct binding studies, solid-phase binding assays where recombinant CD46 is immobilized at approximately 5 μg/mL can effectively measure interactions with purified C3b and C4b, producing reliable dose-response curves with ED50 values typically in the range of 2-12 μg/mL . Surface plasmon resonance (SPR) provides more detailed kinetic information, allowing determination of association and dissociation rates as well as binding affinities under physiological conditions.

For functional studies, cofactor assays measuring Factor I-mediated cleavage of C3b/C4b in the presence of CD46 are essential. These assays typically involve incubating purified C3b/C4b with Factor I and recombinant CD46, followed by SDS-PAGE analysis to visualize the cleavage products . Cell-based assays using flow cytometry can assess the capacity of membrane-bound or recombinant CD46 to protect cells from complement-mediated lysis, providing a functional readout in a physiologically relevant context. When comparing mouse and human CD46, parallel analysis of mouse Crry is recommended since it functionally compensates for CD46's complement regulatory activity in most mouse tissues .

For researchers investigating specific binding sites, competition experiments using monoclonal antibodies targeting different CD46 domains or mutated recombinant CD46 proteins can map the specific regions involved in complement interactions. Finally, confocal microscopy using fluorescently labeled components can visualize CD46-complement interactions in cellular contexts, providing insights into the spatial and temporal dynamics of these interactions.

How might recombinant CD46 be utilized in developing novel therapeutic approaches?

Recombinant CD46 holds significant potential for therapeutic applications, particularly in diseases involving complement dysregulation or pathogen interactions. As a soluble complement regulator, recombinant CD46 could serve as a therapeutic agent in conditions characterized by excessive complement activation, such as atypical hemolytic uremic syndrome (aHUS), where CD46 mutations have been identified . Administration of functional recombinant CD46 could potentially compensate for defective endogenous protein, restoring proper complement regulation.

In infectious disease contexts, recombinant CD46 could function as a decoy receptor to prevent pathogen binding to cellular CD46, potentially disrupting the infection cycle of CD46-utilizing pathogens like measles virus and certain adenoviruses . For therapeutic development, engineered variants with enhanced stability and half-life, such as CD46-Fc fusion proteins, might prove particularly valuable . In autoimmune disease contexts, recombinant CD46 could potentially be used to modulate T cell responses, promoting Tr1 differentiation and IL-10 production to restore regulatory functions that are defective in conditions like multiple sclerosis .

Advanced therapeutic approaches might include CD46-based chimeric antigen receptors (CARs) targeting complement-depositing tumors or CD46-derived peptides that specifically inhibit pathogen binding without affecting complement regulation. Additionally, understanding CD46's role in reproductive biology opens avenues for potential contraceptive approaches or fertility treatments . As research progresses, combination therapies targeting multiple complement regulators, including CD46, CD55, and CD59, might provide more comprehensive protection against complement-mediated damage in various disease states.

What genomic and proteomic approaches can advance our understanding of CD46 function in different species?

Advanced genomic and proteomic approaches can significantly deepen our understanding of CD46 function across species. Comparative genomic analyses examining CD46 gene structure, regulatory elements, and evolutionary conservation patterns can illuminate how species-specific differences evolved and potentially identify functionally critical regions maintained throughout evolution. CRISPR-Cas9 genome editing enables creation of precise knockin or knockout models to study specific CD46 domains or isoforms, providing more refined insights than traditional transgenic approaches .

Single-cell RNA sequencing offers unprecedented resolution for examining CD46 expression patterns across diverse cell populations and states, potentially revealing cell type-specific isoform expression patterns that might be missed in bulk analyses . For protein-level investigations, comprehensive proteomic profiling using high-resolution mass spectrometry can identify CD46 interacting partners in different cellular contexts, potentially revealing species-specific interaction networks. Phosphoproteomics specifically targeting CD46 and its downstream signaling molecules can map signaling cascades activated upon CD46 engagement in different cell types .

Cross-linking proteomics approaches can identify direct binding partners and complement components that interact with CD46 under physiological conditions. Structural biology techniques including cryo-electron microscopy and X-ray crystallography can reveal how species-specific differences in CD46 structure impact function. Finally, systems biology approaches integrating genomic, transcriptomic, and proteomic data with computational modeling can provide a holistic view of CD46's role within broader immunological networks and identify key nodes that differ between species. These multi-omics approaches collectively promise to unravel the complex and multifaceted functions of CD46 across evolutionary boundaries.

What are the most promising future directions for CD46 research in immunology and infectious disease?

The intersection of CD46 with both complement regulation and adaptive immunity positions it as a fascinating target for future research in immunology and infectious disease. One of the most promising directions involves deeper exploration of CD46's role in T cell differentiation and function, particularly investigating how its engagement shapes the balance between inflammatory and regulatory T cell responses . Understanding the molecular mechanisms underlying the defective CD46-mediated Tr1 differentiation observed in multiple sclerosis, rheumatoid arthritis, and asthma could lead to novel therapeutic approaches for autoimmune and inflammatory conditions .

In infectious disease research, further characterization of how pathogens exploit CD46 as an entry receptor could unveil new strategies for preventing or treating infections . Particularly intriguing is the potential development of recombinant soluble CD46 derivatives that could act as decoy receptors, competing with cellular CD46 for pathogen binding without compromising complement regulation. The tissue-specific expression of CD46 isoforms, especially the preferential use of the C isoform by adenovirus serotype 37 in ocular tissues, suggests that targeting specific isoforms might enable more precise therapeutic interventions .

Advanced studies combining transgenic mouse models with sophisticated imaging techniques could visualize CD46-mediated immune processes in real-time, providing unprecedented insights into its dynamic functions in vivo . Finally, exploring the evolutionary divergence of CD46 function between species might reveal why mice have relegated CD46 expression primarily to the testis while maintaining systemic complement regulation through Crry, potentially uncovering novel aspects of complement biology with therapeutic implications .

What standardized protocols should researchers adopt when working with recombinant mouse CD46?

To enhance reproducibility and facilitate cross-laboratory comparisons in CD46 research, standardized protocols are essential. For protein handling, researchers should adopt consistent reconstitution methods for lyophilized recombinant CD46, preferably using sterile PBS at a concentration of 500 μg/mL, followed by gentle mixing rather than vortexing to preserve protein integrity . Storage recommendations should include aliquoting to minimize freeze-thaw cycles and maintaining stocks at -80°C for long-term preservation .

For quality control, a minimum panel of analytical tests should be performed before experimental use, including SDS-PAGE under both reducing and non-reducing conditions to confirm proper molecular weight and disulfide bond formation, and functional assays measuring binding to C3b/C4b or cofactor activity . When comparing different recombinant CD46 preparations, researchers should standardize based on functional activity rather than protein concentration alone, as specific activity can vary between preparations.

For cell-based experiments, consistent protocols for CD46 immobilization on surfaces or addition to culture medium should be established, with careful documentation of concentrations, incubation times, and temperatures. When studying T cell responses, standardized activation conditions including CD46 antibody clones/concentrations and co-stimulatory signals should be adopted . For transgenic mouse experiments, comprehensive genotyping and expression analysis protocols should verify transgene copy number and expression patterns across tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.