Recombinant Mouse Membrane progestin receptor alpha (Paqr7)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Evolutionary Context

Membrane progestin receptor alpha (mPRα/PAQR7) belongs to the progestin and adipoQ receptor (PAQR) family, which mediates rapid, non-genomic (non-classical) progestogen actions in vertebrates. Phylogenetic analysis has revealed that the five vertebrate mPR subtypes—mPRα (PAQR7), mPRβ (PAQR8), mPRγ (PAQR5), mPRδ (PAQR6), and mPRε (PAQR9)—expanded from an ancestral mPRγ found in invertebrates, with mPRα being the most recent addition, present only in gnathostome (jawed) vertebrates . This evolutionary history suggests specialized functions for PAQR7 that emerged later in vertebrate evolution.

Recombinant mouse PAQR7 refers to the artificially produced version of this membrane receptor, typically created through recombinant DNA technology for research applications. This approach allows investigators to study the protein's structure, binding characteristics, and signaling functions in controlled experimental settings.

Membrane Topology and Domain Organization

The PAQR family possesses a distinctive membrane topology that differentiates it from classical steroid receptors. Recent structural studies have significantly advanced our understanding of mPRα architecture, particularly through homology modeling based on other PAQR family members and adiponectin receptors .

Ovarian Function and Fertility

Research utilizing Paqr7 knockout mouse models has demonstrated that PAQR7 plays a crucial role in female reproductive physiology. PAQR7-deficient female mice exhibit significant reproductive abnormalities, including:

  • Reduced fertility with significantly fewer litters and smaller litter sizes

  • Decreased spontaneous ovulation with significantly fewer oocytes produced

  • Prolonged and disturbed estrous cycles

  • Lower serum levels of anti-Müllerian hormone (AMH) and estradiol (E2)

These findings clearly establish PAQR7 as an essential component of normal reproductive function in female mice, mediating progesterone's effects on multiple aspects of ovarian physiology.

Anti-Apoptotic Functions in Granulosa Cells

PAQR7 has been identified as a key mediator of progesterone's anti-apoptotic effects on granulosa cells. Studies in both human KGN cells (a granulosa cell line) and mouse models demonstrate that PAQR7 deficiency significantly increases granulosa cell apoptosis, which can be partially rescued by progesterone supplementation . This anti-apoptotic function appears to be critical for normal follicular development and ovulation.

Generation and Validation of Knockout Models

Researchers have developed Paqr7 knockout mouse models using CRISPR-Cas9 gene editing technology to investigate the physiological roles of this receptor. In one such model, an 812 bp deletion in the third exon of Paqr7 resulted in a frameshift mutation that eliminated amino acids 38-345, effectively preventing expression of functional PAQR7 protein .

G-Protein Coupled Signaling

Extensive data indicate that mPR-dependent progesterone regulation of intracellular signaling is mediated through G-protein activation . This suggests that PAQR7 functions through G-protein coupled signaling pathways to exert its physiological effects, although the specific downstream effects may vary across different tissues and cellular contexts.

Anti-Apoptotic Signaling Pathway

Research has identified the BCL-2/BAX/CASPASE-3 pathway as a key mediator of PAQR7's anti-apoptotic effects in granulosa cells. In Paqr7-/- mice, significantly increased apoptosis was observed in ovarian cells, with corresponding molecular changes:

  • Decreased Bcl2 mRNA and protein expression (anti-apoptotic factor)

  • Increased Bax mRNA and protein expression (pro-apoptotic factor)

  • Elevated Bax/Bcl2 ratio

  • Increased Casp3 mRNA and cleaved-Caspase3 protein

  • Elevated reactive oxygen species (ROS) in ovaries

Table 3: Apoptotic Markers in Wild-type vs. Paqr7 Knockout Ovaries

MarkerWild-type (Paqr7+/+)Knockout (Paqr7-/-)Significance
Bcl2 mRNAHigher expressionSignificantly decreasedP < 0.01
Bax mRNALower expressionSignificantly increasedP < 0.05
Casp3 mRNALower expressionSignificantly increasedP < 0.05
Cleaved-Caspase3 proteinLower levelsSignificantly elevatedP < 0.05
TUNEL-positive cellsFewerSignificantly increasedP < 0.05

Interaction with Other Membrane Receptors

PAQR7 has been shown to closely associate with progesterone receptor membrane component 1 (PGRMC1), which can function as an adaptor protein to facilitate cell-surface expression of PAQR7 and PAQR7-dependent progesterone signaling . This interaction has been demonstrated in several vertebrate models and suggests complex receptor dynamics at the cell membrane.

Association with Decreased Ovarian Reserve

Research has identified lower PAQR7 protein levels in granulosa cells isolated from follicular fluids of patients diagnosed with decreased ovarian reserve (DOR), a common condition of ovarian dysfunction . Similar findings were observed in mouse models with DOR-like phenotypes, which showed significantly reduced PAQR7 expression compared to controls.

These observations suggest that PAQR7 may play a role in the pathophysiology of DOR and potentially other conditions affecting ovarian function and female fertility, highlighting its clinical relevance.

Potential Compensatory Mechanisms

Interestingly, complete sterility was not observed in Paqr7 knockout female mice, suggesting possible compensatory mechanisms within the progesterone receptor family. Studies have shown significant upregulation of other receptor genes in Paqr7 knockout mice, including nuclear progesterone receptor (Pgr), neudesin neurotrophic factor (Nenf), and other PAQR family members (Paqr5, Paqr6, Paqr8, and Paqr9) . These findings indicate that certain receptors may partially compensate for PAQR7 deficiency.

Current Research Challenges and Future Directions

Despite significant advances in understanding PAQR7's structure and function, several aspects remain to be fully elucidated:

  • Complete three-dimensional structure of PAQR7 in its native membrane environment

  • Precise molecular mechanisms of signal transduction downstream of PAQR7 activation

  • Role of PAQR7 in ovarian development and aging processes

  • Potential for targeting PAQR7 therapeutically in reproductive disorders

  • Interaction and functional overlap between PAQR7 and other membrane progesterone receptors

Further research into these areas may yield valuable insights for reproductive medicine and could potentially lead to novel therapeutic approaches for treating conditions associated with abnormal ovarian function, such as premature ovarian failure, infertility, or polycystic ovary syndrome.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Paqr7; Mpra; Pglp; Membrane progestin receptor alpha; mPR alpha; Membrane progesterone P4 receptor alpha; Membrane progesterone receptor alpha; PPAR-gamma-induced liver protein; Progesterone and adipoQ receptor family member 7; Progestin and adipoQ receptor family member 7; Progestin and adipoQ receptor family member VII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Paqr7
Target Protein Sequence
MAMAVAQKFNHLLSSLWHVGQKPPQPEPVFTVDRAQVPPLFWKPYIYAGYRPLHQNWCFY FRTLFQRHNEAVNVWTHLLAALALLLRLIGLAASVDFREDPHALPLFFIVLASFTYLSFS AVAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHDKVQAIFLPTAAFL AWLSCAGSCYNKYSQKPGLLGRIFQEAPSALAYVLDISPVLHRIIVSPLPAEEDPALLYH KCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARR GIYEPLHARWPHNFSGLFLLTVASSSLTALLLSQLVRRKLHQKTK
Uniprot No.

Target Background

Function
Membrane progestin receptor alpha (Paqr7) is a G protein-coupled receptor located on the plasma membrane. It appears to function through a G(i)-mediated pathway and may be involved in oocyte maturation and neurosteroid inhibition of apoptosis. It also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone, and allopregnanolone.
Gene References Into Functions
  1. Paqr7 and Paqr8 are expressed in the midbrain ventral tegmental area of proestrous mice. PMID: 24269738
Database Links
Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in most adult tissues. Higher expression found in white fat and liver than brown fat and skeletal muscle.

Q&A

What is the membrane topology of mouse Paqr7 and how does it compare to other PAQR family members?

Mouse Paqr7 (mPRα) features a seven-transmembrane domain structure similar to other members of the progestin and adipoQ receptor (PAQR) family. The receptor's membrane topology has been predicted through homology modeling based on structures of other PAQRs, particularly adiponectin receptors. The protein contains a zinc-binding cavity that is essential for its function. The membrane topology includes an extracellular N-terminus and intracellular C-terminus, which is opposite to the orientation of classical G protein-coupled receptors. This structure has been confirmed through multiple experimental approaches including mutational analysis and binding assays .

What are the binding characteristics of mouse Paqr7 for progesterone and other steroids?

Mouse Paqr7 exhibits high-affinity, limited-capacity, specific binding for progesterone. The binding parameters are comparable to human mPRα, which shows a dissociation constant (Kd) of 2.5-7 nM and limited binding capacity (Bmax 0.03-0.72 nM). Among other natural steroids, 21-hydroxyprogesterone and testosterone can bind to the receptor but with relative binding affinities (RBA) of only approximately 20% compared to progesterone. The neurosteroid allopregnanolone also binds to mPRs with lower affinity (approximately 5% RBA for mPRα). These binding characteristics highlight the specificity of Paqr7 for progesterone as its primary physiological ligand .

What expression systems are most effective for producing recombinant mouse Paqr7?

Several expression systems have been used for recombinant production of mPRs, with varying degrees of success. While the search results primarily discuss human mPRα expression, the methodologies are applicable to mouse Paqr7:

  • Yeast expression systems: Methylotrophic yeast Pichia pastoris has proven particularly effective for producing functional recombinant mPRα. This system has been optimized to generate substantial amounts of active receptor protein through modifications of culture conditions, homogenization protocols, and column chromatography parameters .

  • Bacterial expression systems: Escherichia coli has been used but typically produces lower yields of functional protein compared to yeast systems .

  • Mammalian expression systems: While these can produce properly folded protein, they require long-term culture for sufficient plasma membrane expression. The receptor must be assayed rapidly (within 30 minutes at 4°C) to prevent degradation and loss of progesterone binding .

For mouse Paqr7 specifically, adapting the optimized yeast expression protocol developed for human mPRα is recommended, with adjustments for species-specific codon optimization and potential differences in post-translational modifications .

What are the critical factors for maintaining the stability and activity of purified recombinant mouse Paqr7?

Several critical factors must be considered when working with purified recombinant Paqr7:

  • Temperature conditions: The purified protein must be handled at 4°C to prevent rapid degradation. Binding assays should be performed within 30 minutes of purification to maintain activity .

  • Membrane environment: mPRs require an appropriate lipid environment to maintain their native conformation and function. Detergent selection during purification is critical, as is the potential reconstitution into liposomes or nanodiscs for functional studies .

  • Metal ion availability: Zinc ions are essential for the structure and function of Paqr7. The addition of zinc (100 μM) has been shown to restore progesterone binding in certain mutants, indicating its importance for maintaining the receptor's binding pocket integrity .

  • Storage conditions: Flash freezing in appropriate buffer systems with cryoprotectants is typically required to preserve activity for longer periods. Multiple freeze-thaw cycles should be avoided .

  • Protein concentration: Working with Paqr7 at appropriate concentrations is important, as the protein may aggregate at high concentrations, leading to loss of activity .

How is the ligand-binding domain of Paqr7 structured, and what residues are critical for progesterone binding?

The ligand-binding domain (LBD) of mPRα has been identified through homology modeling based on the structure of adiponectin receptors (AdipoRs), combined with mutational analysis and ligand binding studies. The binding pocket is located within the transmembrane domains of the receptor.

Key structural features include:

  • Essential amino acid residues: Glutamine 206 on transmembrane domain 5 (TM5) is critical, forming an essential hydrogen bond interaction with the 20-carbonyl group of progesterone. Mutational analysis confirmed this by substituting alanine (which cannot donate an H-bond), resulting in complete loss of progesterone binding .

  • Metal coordination: The binding pocket includes a zinc-binding site that is essential for maintaining the structural integrity of the LBD. When glutamine 206 was substituted with arginine, progesterone binding was lost but could be restored by adding 100 μM zinc, indicating the importance of metal coordination in maintaining proper binding pocket conformation .

  • Structural homology: The LBD shows significant structural similarity to AdipoRs, as demonstrated by the ability of AdipoR1 to bind progesterone in the presence of zinc. This structural homology extends to functional interactions, with AdipoRon (an AdipoR synthetic agonist) showing affinity for mPRα and activating mPR-dependent signaling .

What methodological approaches can be used to screen for novel Paqr7 ligands or antagonists?

Researchers can employ several methodological approaches to screen for novel Paqr7 ligands or antagonists:

  • Competitive binding assays: Using purified recombinant Paqr7 and [³H]-progesterone as a tracer, researchers can perform displacement studies to identify compounds that compete for binding to the receptor. This approach can determine relative binding affinities of potential ligands .

  • Functional assays: Since Paqr7 couples to G proteins, particularly inhibitory G (Gi) proteins, assays measuring changes in second messenger systems (such as cAMP levels or Ca²⁺ flux) can be used to identify compounds with agonist or antagonist activity .

  • Proximity ligation assays (PLA): This technique can detect the association between Paqr7 and G proteins or other signaling components in the presence of test compounds, providing insights into their effects on receptor-effector coupling .

  • Purified protein screening: The established method for expressing and purifying recombinant mPRα in yeast systems can provide sufficient quantities of active protein for high-throughput screening against compound libraries .

  • Cell-based reporter assays: Transfecting cells with Paqr7 and appropriate reporter constructs linked to G protein signaling pathways can facilitate screening for compounds that modulate receptor activity .

How does mouse Paqr7 couple to G proteins, and which second messenger systems are activated?

Mouse Paqr7 (mPRα) primarily couples to inhibitory G (Gi) proteins to mediate its signaling effects. This coupling has been confirmed through multiple experimental approaches including co-immunoprecipitation, G protein inhibitor studies, and proximity ligation assays (PLA) .

The G protein coupling profile differs among mPR subtypes:

  • mPRα (Paqr7), mPRβ (Paqr8), and mPRγ (Paqr5) couple to inhibitory G (Gi) proteins

  • mPRδ (Paqr6) and mPRε (Paqr9) couple to stimulatory G (Gs) proteins

Activation of Paqr7 by progesterone leads to:

  • Inhibition of adenylyl cyclase activity via Gi protein activation

  • Reduction in intracellular cAMP levels

  • Modulation of downstream signaling cascades including MAPK pathways

  • Activation of anti-apoptotic pathways, particularly the BCL-2/BAX/CASPASE-3 pathway

The G protein coupling can be experimentally demonstrated using pertussis toxin (PTX), which decouples inhibitory G proteins from receptors. Treatment with activated pertussis toxin (aPTX) significantly reduces the association between Paqr7 and G proteins, confirming the Gi-mediated signaling mechanism .

What is the relationship between Paqr7 and PGRMC1, and how does this affect progesterone signaling?

Paqr7 (mPRα) and Progesterone Receptor Membrane Component 1 (PGRMC1) have a close functional relationship that significantly impacts progesterone signaling:

  • Physical association: Extensive research has demonstrated that PGRMC1 physically associates with Paqr7, serving as an adaptor protein that facilitates the proper cell-surface expression of Paqr7 .

  • Membrane localization: PGRMC1 mediates the cell-surface expression of Paqr7, which is critical for its ability to bind extracellular progesterone and initiate signaling .

  • Signaling facilitation: PGRMC1 not only helps localize Paqr7 to the plasma membrane but also participates in mediating Paqr7-dependent progesterone signaling cascades .

  • Experimental evidence: This relationship has been demonstrated in several vertebrate models, suggesting it is evolutionarily conserved and physiologically significant .

  • Contextual importance: The relationship between these two distinct progesterone-responsive proteins provides a mechanism for fine-tuning cellular responses to progesterone across different tissues and physiological states .

This interaction represents an important consideration for researchers working with recombinant Paqr7, as the absence of PGRMC1 in some expression systems may limit proper membrane localization and signaling capacity of the recombinant receptor.

What reproductive phenotypes are associated with Paqr7 knockout in female mice?

Paqr7 knockout (Paqr7^(-/-)) female mice exhibit several significant reproductive phenotypes that demonstrate the critical role of this receptor in ovarian function and female fertility:

  • Reduced fertility: Paqr7^(-/-) female mice show significantly decreased litters and litter sizes compared to wild-type mice, indicating substantial fertility impairment .

  • Ovulation defects: Knockout females produce significantly fewer oocytes during spontaneous ovulation compared to wild-type mice .

  • Estrous cycle abnormalities: The estrous cycle in Paqr7^(-/-) mice is disturbed and prolonged, with an increased presence of white blood cells during diestrus .

  • Follicular development impairment: Histological analysis reveals:

    • Fewer primordial (PMF), primary (PF), secondary (SF), and antral (ANF) follicles

    • No significant difference in atretic follicles (ATF)

    • Abnormal ovarian microstructure with ovarian atrophy and cortical thickening

    • Fewer blood vessels

    • Loose and irregular arrangement of luteal granulosa cells

  • Hormonal imbalances: Paqr7^(-/-) female mice exhibit:

    • Significantly lower serum anti-Müllerian hormone (AMH) levels

    • Reduced estradiol (E2) concentrations

    • No significant changes in progesterone (P4) and follicle-stimulating hormone (FSH) levels

Importantly, these reproductive phenotypes occur despite normal growth, development, and viability of the Paqr7^(-/-) mice, indicating a specific role for this receptor in reproductive function rather than general physiological processes .

What cellular and molecular mechanisms explain the anti-apoptotic effects of Paqr7 in granulosa cells?

Paqr7 mediates the anti-apoptotic effects of progesterone in granulosa cells through several key molecular pathways:

  • BCL-2/BAX regulation: Paqr7 activation by progesterone upregulates the anti-apoptotic protein BCL-2 while downregulating the pro-apoptotic protein BAX. In Paqr7^(-/-) mice, Bcl2 mRNA and protein are significantly decreased while Bax levels are increased .

  • Bax/Bcl-2 ratio modulation: The ratio between pro-apoptotic Bax and anti-apoptotic Bcl-2 is elevated in the ovaries of Paqr7^(-/-) mice, creating a cellular environment that favors apoptosis .

  • Caspase pathway inhibition: Progesterone signaling through Paqr7 inhibits Caspase-3 activation. In Paqr7^(-/-) mice, cleaved-Caspase3 levels are elevated, indicating increased apoptotic activity .

  • Oxidative stress regulation: Reactive oxygen species (ROS) levels are elevated within the ovaries of Paqr7^(-/-) mice, suggesting that Paqr7 signaling normally suppresses oxidative stress that can trigger apoptotic pathways .

  • G protein-mediated signaling: The anti-apoptotic effects likely involve Paqr7's coupling to inhibitory G proteins, which modulate downstream signaling pathways that regulate cell survival and apoptosis .

These findings were confirmed through multiple experimental approaches:

  • TUNEL assays showing increased TUNEL-positive cells in Paqr7^(-/-) ovaries

  • qPCR analysis of apoptosis-related gene expression

  • Western blot confirmation of protein-level changes

  • In vitro studies using the human granulosa cell line KGN with PAQR7 knockdown

The anti-apoptotic role of Paqr7 appears particularly important in maintaining healthy follicular development and preventing premature follicular atresia, which explains many of the reproductive phenotypes observed in knockout mice.

How can recombinant mouse Paqr7 be used to screen for endocrine-disrupting chemicals?

Recombinant mouse Paqr7 offers a valuable platform for screening potential endocrine-disrupting chemicals (EDCs) that may interfere with progesterone signaling. A methodological approach would include:

  • Competitive binding assays: Purified recombinant Paqr7 can be used in direct binding studies to identify chemicals that compete with [³H]-progesterone. This allows for quantitative determination of binding affinity and screening of large compound libraries .

  • Functional signaling assays: Since Paqr7 couples to inhibitory G proteins and modulates cAMP levels, assays measuring changes in second messenger cascades can identify compounds that act as agonists or antagonists. This approach detects functional interference beyond simple binding competition .

  • Cell-based reporter systems: Establishing stable cell lines expressing recombinant mouse Paqr7 along with appropriate reporter constructs (such as cAMP-responsive elements driving luciferase expression) enables high-throughput screening of compounds that modulate receptor function .

  • Structural studies: The optimized expression and purification system for recombinant Paqr7 provides sufficient material for structural studies that could identify potential binding modes of EDCs, especially when combined with molecular docking approaches .

  • Comparative analysis: Testing compounds against multiple mPR subtypes (α, β, γ, δ, ε) allows for determining subtype selectivity of potential EDCs, which is important for predicting tissue-specific effects .

This methodology is particularly relevant given that Paqr7 mediates rapid, non-genomic progesterone effects that are distinct from classical nuclear progesterone receptor signaling, potentially revealing a previously underappreciated mechanism for endocrine disruption .

What experimental approaches can assess the interactions between Paqr7 and other hormone receptor signaling pathways?

Several sophisticated experimental approaches can be employed to investigate the cross-talk between Paqr7 and other hormone receptor signaling pathways:

  • Proximity ligation assays (PLA): This technique can detect close physical associations between Paqr7 and other membrane receptors or signaling components in intact cells, revealing potential protein complexes that facilitate signaling cross-talk .

  • FRET/BRET analysis: Fluorescence or bioluminescence resonance energy transfer techniques using tagged receptors can detect dynamic interactions between Paqr7 and other receptors in living cells, providing real-time visualization of receptor dimerization or complex formation .

  • Co-immunoprecipitation combined with mass spectrometry: This approach can identify novel protein interactions with Paqr7 in different cellular contexts, revealing potential signaling partners or regulatory proteins that mediate cross-talk .

  • Phosphoproteomic analysis: Comparing the phosphorylation patterns induced by Paqr7 activation alone versus co-activation with other hormone receptors can identify shared or divergent signaling nodes .

  • CRISPR-Cas9 gene editing: Creating cell lines with specific receptor knockouts or mutations can help delineate the contribution of each receptor to observed physiological responses .

  • Conditional tissue-specific knockout models: Generating mice with tissue-specific and/or inducible Paqr7 deletion, combined with manipulations of other hormone systems, can reveal in vivo relevance of receptor cross-talk .

  • Signaling inhibitor studies: Systematic application of specific inhibitors targeting different components of hormone signaling pathways can map the nodes where Paqr7 signaling converges with or diverges from other hormone pathways .

Evidence suggests that Paqr7 can regulate the activity of other hormone receptors, making these approaches valuable for understanding the complex integration of multiple hormonal signals in reproductive and non-reproductive tissues .

What is the relationship between Paqr7 expression and decreased ovarian reserve (DOR)?

Research has revealed a significant relationship between Paqr7 expression and decreased ovarian reserve (DOR):

  • Clinical evidence: PAQR7 protein levels are markedly reduced in granulosa cells isolated from follicular fluids of patients diagnosed with decreased ovarian reserve compared to control patients .

  • Animal model confirmation: In mouse models of DOR-like phenotype, ovarian PAQR7 levels are significantly lower compared to control mice, providing a parallel to the human clinical findings .

  • Mechanistic link: The decreased expression of PAQR7 in DOR appears mechanistically linked to increased granulosa cell apoptosis. Without sufficient PAQR7, progesterone's anti-apoptotic effects are diminished, leading to premature follicular atresia and reduced ovarian reserve .

  • Phenotypic similarity: The reproductive phenotypes observed in Paqr7^(-/-) mice mirror several key aspects of DOR in humans, including:

    • Reduced follicular development

    • Decreased AMH levels

    • Lower estradiol production

    • Impaired fertility

  • Potential biomarker: These findings suggest that PAQR7 expression levels could potentially serve as a biomarker for assessing ovarian reserve and predicting reproductive outcomes .

This relationship provides important insights into the molecular mechanisms underlying DOR and suggests that therapies targeting Paqr7 signaling might have potential for preventing or treating this condition. Further research is needed to determine whether PAQR7 dysregulation is a cause or consequence of DOR, and whether interventions to restore normal PAQR7 function could improve ovarian function in affected individuals .

How can recombinant Paqr7 be used to develop novel contraceptive or fertility enhancement approaches?

Recombinant Paqr7 offers promising avenues for developing both contraceptive strategies and fertility enhancement approaches:

Contraceptive Development:

  • Selective antagonists: The ability to produce purified recombinant Paqr7 enables high-throughput screening for selective antagonists that could block progesterone's actions specifically through this receptor without affecting nuclear progesterone receptor signaling .

  • Structure-based drug design: The optimized expression system provides sufficient material for structural studies that could guide the rational design of Paqr7-specific modulators with contraceptive potential .

  • Targeted delivery systems: Knowledge of Paqr7's role in reproductive tissues allows for the development of targeted delivery systems that could localize contraceptive agents to specific reproductive tissues, minimizing systemic effects .

  • Mechanism-based approach: Understanding that Paqr7 mediates anti-apoptotic effects in granulosa cells provides a specific mechanism that could be targeted to induce controlled follicular atresia as a contraceptive strategy .

Fertility Enhancement:

  • Agonist development: Screening for selective Paqr7 agonists that enhance the receptor's anti-apoptotic effects could potentially improve follicular survival and development .

  • DOR therapy: Given the reduced expression of PAQR7 in patients with decreased ovarian reserve, therapies aimed at increasing PAQR7 expression or enhancing its signaling could potentially improve ovarian function in these patients .

  • Granulosa cell protection: Paqr7 agonists could be used to protect granulosa cells during assisted reproductive procedures, potentially improving oocyte quality and IVF outcomes .

  • Combination approaches: Understanding the relationship between Paqr7 and other reproductive hormone receptors enables the development of combination therapies that target multiple pathways to enhance fertility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.