Recombinant Mouse Membrane progestin receptor beta (Paqr8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your formulation.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize development based on your specification.
Synonyms
Paqr8; Mprb; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor family member 8; Progestin and adipoQ receptor family member VIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Paqr8
Target Protein Sequence
MTTAILERLSTLSMSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAI LLDYQGRHEIFLQRHGPLSVYSACLSFFVLAACSAATATLLRHKVKDRLIKKDS
Uniprot No.

Target Background

Function
Plasma membrane progesterone (P4) receptor coupled to G proteins. It appears to function through a G(i) mediated pathway. May be involved in oocyte maturation. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone, and allopregnanolone.
Database Links
Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain and testis.

Q&A

What is the membrane progestin receptor beta (Paqr8) and how does it differ from nuclear progesterone receptors?

Membrane progestin receptor beta (mPR-beta/Paqr8) belongs to a group of membrane proteins unrelated to nuclear steroid receptors. It is part of the seven-transmembrane progesterone adiponectin Q receptor (PAQR) family, which includes three main subtypes: alpha, beta, and gamma. Unlike nuclear progesterone receptors that mediate genomic effects through transcriptional regulation, mPR-beta is involved in rapid, non-genomic progestin actions initiated at the cell surface . These membrane receptors typically couple to G proteins and activate pertussis-sensitive inhibitory G proteins (Gi) to down-regulate adenylyl cyclase activity, representing a distinct signaling mechanism from nuclear progesterone receptors .

What is the structural characterization of mouse mPR-beta compared to other mPR subtypes?

Mouse mPR-beta, like other mPRs, has a molecular weight of approximately 40 kDa and features a seven-transmembrane domain structure characteristic of the PAQR family . Bioinformatic analysis has revealed that mPR-beta contains an endoplasmic reticulum (ER) retention motif and an endocytosis internalization motif, which may explain its differential subcellular localization patterns observed in various cell types . While all three mPR subtypes (alpha, beta, gamma) share structural similarities, their tissue distribution and functional roles differ, with mPR-beta showing distinct localization patterns compared to mPR-alpha, which has been more extensively characterized in reproductive tissues .

How has the expression pattern of mPR-beta been characterized in different tissues?

Studies have characterized mPR-beta expression in various tissues, particularly in reproductive systems. In pig cumulus-oocyte complexes (COCs), both transcripts and proteins for mPR-beta have been detected using RT-PCR and Western blot analysis . The expression of mPR-beta in COCs shows a dynamic pattern during in vitro maturation (IVM), with levels increasing between 0 and 20 hours, followed by a decrease between 20 and 44 hours . Immunofluorescence analysis has shown that mPR-beta localizes to the plasma membrane of cumulus cells, while in mouse embryonic fibroblasts (MEFs), it is predominantly detected in the endoplasmic reticulum rather than the plasma membrane . This differential localization suggests tissue-specific functions and regulatory mechanisms.

What expression systems have been most successful for producing recombinant mouse mPR-beta?

Several expression systems have been employed for recombinant production of membrane progestin receptors, including bacterial (E. coli) and eukaryotic expression systems . For mouse progestin receptors, mammalian cell expression systems using CMV-based plasmids such as pcDNAI have been successful . Additionally, baculovirus expression systems using vectors like pAcG2T have been utilized to express PRs as fusion proteins with N-terminal glutathione S-transferase (GST) tags . For mPR-beta specifically, both bacterial systems and eukaryotic systems like human breast cancer cells (MDA-MB-231 cells, nuclear progesterone receptor negative) have demonstrated successful expression of functional recombinant protein . The choice of expression system depends on the research objectives, with eukaryotic systems generally providing better post-translational modifications and proper membrane insertion.

What are the key challenges in expressing functional recombinant mPR-beta in membrane systems?

A major technical challenge in mPR-beta research has been expressing sufficient amounts of recombinant receptors on plasma membranes in eukaryotic systems to enable investigations of their progestin binding and signal transduction characteristics . Recombinant membrane receptors often experience rapid degradation during purification attempts . Additionally, proper membrane insertion and retention are critical challenges, as mPR-beta contains an ER retention motif that can affect its trafficking to the plasma membrane . Researchers should consider using specialized membrane protein expression systems with appropriate chaperones and optimized membrane insertion sequences. For functional studies, confirming proper folding and orientation in the membrane through binding assays is essential to ensure the recombinant receptor maintains its native properties.

What purification strategies yield the highest quality recombinant mPR-beta protein?

While the search results don't provide specific purification protocols for mPR-beta, lessons from related membrane receptor work suggest several approaches. For GST-tagged recombinant mPR-beta, affinity chromatography using glutathione-sepharose can provide initial purification . Given the challenges of membrane protein degradation, incorporating protease inhibitors throughout the purification process is critical. Size exclusion chromatography can help separate properly folded receptor from aggregates. For functional studies, it may be preferable to use membrane preparations rather than fully purified protein to maintain the native lipid environment. Researchers should validate purified preparations through binding assays to confirm that the recombinant protein maintains high-affinity progestin binding with appropriate kinetics (Kd ~4-8 nM for related mPRs) and limited capacity (Bmax 0.03-0.3 nM) .

What binding assays are most appropriate for characterizing recombinant mPR-beta function?

Radioligand binding assays using [³H]-labeled progestins have been successfully employed to characterize recombinant mPRs, including determination of binding affinity (Kd), capacity (Bmax), and specificity . Properly characterized recombinant mPRs should display high affinity (Kd 4-8 nM), limited capacity (Bmax 0.03-0.3 nM), and displaceable progestin binding, with rapid rates of association and dissociation (T½: 2-5 min) . Competition binding assays using unlabeled steroids can determine binding specificity. For mPR-beta specifically, it's important to control for potential binding to other steroid receptors by using cells that lack nuclear progesterone receptors. Non-radioactive alternatives include fluorescently labeled progestins and surface plasmon resonance, though these may require optimization for the specific properties of mPR-beta.

How can researchers distinguish between mPR-beta-mediated signaling and effects via nuclear progesterone receptors?

To distinguish mPR-beta-mediated signaling from nuclear progesterone receptor effects, researchers can employ several complementary approaches. First, use cell lines that lack nuclear progesterone receptors (PR-negative) but express recombinant mPR-beta . Second, utilize membrane-impermeable progestin analogs that selectively activate membrane receptors without affecting nuclear receptors. Third, examine rapid signaling events (seconds to minutes) that occur too quickly to involve transcriptional regulation by nuclear receptors, such as changes in cAMP levels, calcium mobilization, or MAPK activation . Fourth, pharmacological inhibition of G-protein signaling (particularly Gi proteins) can help confirm mPR-beta involvement, as these receptors typically couple to pertussis toxin-sensitive G proteins . Finally, antibody neutralization experiments, similar to those showing impaired cumulus expansion with anti-mPR-beta serum, can provide evidence of mPR-beta-specific functions .

What signaling pathways are activated by recombinant mPR-beta, and how should they be measured?

While the search results don't provide specific signaling pathway information exclusive to mPR-beta, data from related mPRs indicate they typically activate pertussis-sensitive inhibitory G proteins (Gi) to down-regulate adenylyl cyclase activity . To measure these pathways, researchers should consider assessing:

  • cAMP levels using enzyme immunoassays or FRET-based reporters

  • G-protein activation through [³⁵S]GTPγS binding assays

  • Adenylyl cyclase activity measurements

  • Downstream effects on protein kinase A (PKA) phosphorylation targets

  • Potential cross-talk with MAPK pathways

Experiments should include appropriate positive and negative controls, including pertussis toxin treatment to inhibit Gi proteins and comparison with cells lacking mPR-beta expression. Time-course experiments are essential, as membrane receptor signaling typically produces rapid responses (within minutes) compared to nuclear receptor-mediated effects .

What is the role of mPR-beta in oocyte maturation and reproductive biology?

Research suggests that mPR-beta plays a significant role in reproductive biology, particularly in oocyte maturation. Studies in pig cumulus-oocyte complexes (COCs) have shown that mPR-beta is involved in cumulus expansion during in vitro maturation (IVM) . When COCs were incubated with anti-mPR-beta serum during IVM, cumulus expansion was significantly impaired (P<0.05), indicating that mPR-beta is required for this process . The dynamic expression pattern of mPR-beta during IVM (increasing between 0-20h and decreasing between 20-44h) suggests temporal regulation of its function . Unlike mPR-alpha, which has been directly implicated in progestin induction of oocyte maturation in fish, mPR-beta may function through regulation of exocytosis, potentially involving its endocytosis internalization motif . Researchers investigating mPR-beta's role in reproduction should consider its tissue-specific localization patterns and potential interaction with other reproductive hormone receptors.

How does mPR-beta subcellular localization influence its function across different cell types?

The subcellular localization of mPR-beta varies significantly between cell types, which likely impacts its functional properties. In cumulus cells, mPR-beta localizes primarily to the plasma membrane, where it can interact directly with extracellular ligands . In contrast, in mouse embryonic fibroblasts (MEFs), mPR-beta is predominantly detected in the endoplasmic reticulum (ER) rather than the plasma membrane . This differential localization can be explained by the presence of an ER retention motif identified through bioinformatic analysis . The subcellular localization has profound implications for function: plasma membrane localization facilitates direct response to extracellular progestins, while ER localization may involve regulation of intracellular calcium stores or protein trafficking. Researchers investigating mPR-beta should carefully characterize its localization in their specific cell system using subcellular fractionation and immunofluorescence with appropriate markers for different cellular compartments, as localization will determine the receptor's ability to respond to various ligands and participate in different signaling pathways.

What is the potential role of mPR-beta/Paqr8 in breast cancer and therapeutic resistance?

Recent evidence suggests a potential role for PAQR8 (mPR-beta) in breast cancer, particularly in therapeutic resistance. Analysis of metastatic breast cancer genomics revealed that PAQR8 gain was mutually exclusive with mutations in the nuclear estrogen and progesterone receptors (66.7% of ESR1/PGR-wild-type metastases exhibited PAQR8 copy number gain compared with only 11.1% of ESR1/PGR mutant metastases, P = 0.0062) . This pattern suggests that PAQR8 gain may represent an alternative mechanism of resistance to endocrine therapies as well as chemotherapy . Interestingly, PAQR8 gain was associated with decreased disease-specific survival, but only within a specific molecular subtype of breast cancer (IntClust7, a subgroup of luminal A tumors) . These findings indicate that mPR-beta may contribute to cancer progression through non-genomic signaling pathways that bypass classical hormone receptor dependencies. Researchers investigating mPR-beta in cancer should consider analyzing its expression in relation to treatment response and exploring combination therapies that target both nuclear and membrane progestin signaling pathways.

How can researchers design experiments to investigate the interactions between mPR-beta and G proteins?

To investigate mPR-beta interactions with G proteins, researchers should design experiments that:

  • Express recombinant mPR-beta together with specific G protein subunits in appropriate cell systems

  • Perform co-immunoprecipitation assays to detect physical interactions between mPR-beta and G protein subunits

  • Utilize [³⁵S]GTPγS binding assays to measure G protein activation in response to progestin stimulation

  • Employ pertussis toxin treatment to specifically inhibit Gi/o proteins and determine their involvement

  • Use FRET or BRET-based biosensors to monitor real-time dynamics of mPR-beta-G protein interactions

  • Analyze downstream signaling events, such as changes in cAMP levels or ERK/MAPK phosphorylation

When designing these experiments, researchers should include appropriate controls including receptor-negative cells, constitutively active and dominant-negative G protein mutants, and selective mPR agonists and antagonists. The experimental design should account for the rapid kinetics of G protein signaling, with appropriate time points to capture both immediate (seconds to minutes) and longer-term (minutes to hours) responses.

What are the most common technical challenges in mPR-beta research and how can they be addressed?

Several technical challenges complicate mPR-beta research:

  • Protein degradation and instability: Incorporate protease inhibitors throughout isolation procedures and consider membrane-mimetic environments for stabilization .

  • Plasma membrane expression: The presence of an ER retention motif in mPR-beta can limit cell surface expression . Consider using trafficking enhancement sequences or mutations of the ER retention motif to improve plasma membrane localization.

  • Distinguishing from nuclear receptor effects: Use PR-negative cells, membrane-impermeable ligands, and focus on rapid signaling responses to isolate mPR-beta effects .

  • Antibody specificity: Validate antibodies using knockout/knockdown controls and recombinant protein, as cross-reactivity with other PAQR family members can complicate interpretation.

  • Functional redundancy: Design experiments to account for potential compensation by other mPR subtypes, using combinatorial knockdown/knockout approaches.

  • Tissue-specific differences: Be aware that mPR-beta localization and function vary between tissues, necessitating validation in each experimental system .

How should researchers design experiments to investigate the physiological relevance of mPR-beta in vivo?

To establish the physiological relevance of mPR-beta in vivo, researchers should consider:

  • Generating conditional knockout models: Create tissue-specific mPR-beta knockout mice to avoid developmental compensation and study tissue-specific functions.

  • Physiological phenotyping: Comprehensively assess reproductive parameters including fertility, oocyte maturation, corpus luteum formation, and pregnancy outcomes in knockout models.

  • Rescue experiments: Express wild-type or mutant mPR-beta in knockout backgrounds to confirm specificity and identify crucial domains.

  • Ligand specificity: Use specific mPR-beta agonists/antagonists that don't activate nuclear progesterone receptors.

  • Temporal studies: Investigate age-dependent effects and hormonal cycle variations on mPR-beta expression and function.

  • Relevant disease models: In cancer studies, use patient-derived xenografts with varying levels of mPR-beta expression to study treatment resistance .

  • Combinatorial approaches: Assess potential redundancy or cooperation between different mPR subtypes using combination knockouts.

  • Single-cell analysis: Employ single-cell transcriptomics and proteomics to identify cell populations where mPR-beta signaling is particularly important.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.