Recombinant Mouse Membrane protein FAM159A (Fam159a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Shisal2a; Fam159a; Protein shisa-like-2A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Shisal2a
Target Protein Sequence
MSGACSSYVSAEQEVVRGFSCPLPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHNYMWWL SIGALVGLSTAAVVLLAFLITACVLCYLFISSKPQTKLDPGLSLQTTGSKEMSPDHHGLN TAIPMEVPGVSSPRQSSSSNTHLESNKKQTVSPTCLPQNQFMATVTASNIPGSPDEISVP TPGPHGPVP
Uniprot No.

Target Background

Database Links

KEGG: mmu:545667

UniGene: Mm.380025

Protein Families
Shisa family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM159A and how does it differ from FAM159B?

FAM159A is one of two FAM159 isoforms present in vertebrates, alongside FAM159B. Both belong to the Shisa-like protein family, but they substantially differ in their amino acid sequences . FAM159A is considered a transmembrane adaptor protein involved in regulating other transmembrane receptors and proteins, similar to FAM159B, though with potentially distinct functions due to their sequence differences. When designing experiments involving FAM159A, it's critical to use specific antibodies that don't cross-react with FAM159B, as the C-terminal regions between these proteins show significant differences .

What is the expression pattern of FAM159A in mouse tissues?

While comprehensive data on FAM159A expression patterns is still being established, researchers should consider examining similar tissues where FAM159B has been detected, including neuronal and neuroendocrine cells and tissues . Based on our understanding of the FAM159 family, potential expression sites for FAM159A may include:

Tissue TypeExpected Expression LevelVerification Method
Neuronal tissuesModerate to highImmunohistochemistry
Pancreatic tissuesPotentially presentqPCR and Western blot
Gastrointestinal tractVariableRNA sequencing
Endocrine organsPotentially presentImmunofluorescence

Researchers should verify expression patterns through multiple methods, including qPCR, Western blotting, and immunohistochemistry using FAM159A-specific antibodies.

What experimental controls should be used when studying recombinant mouse FAM159A?

When studying recombinant mouse FAM159A, implement both positive and negative controls. For antibody specificity, preadsorption tests with the immunizing peptide should completely abolish the immunosignal, similar to validation methods used for FAM159B . Additionally, include:

  • Empty vector controls in transfection experiments

  • Isotype controls for immunohistochemistry

  • Tissue samples known to be negative for FAM159A expression

  • Cross-validation using multiple antibodies targeting different epitopes

  • Knockout/knockdown controls when available

For recombinant protein production, verify protein integrity through SDS-PAGE and mass spectrometry before functional studies.

How should researchers design experiments to investigate potential functions of FAM159A in relation to signal transduction?

As FAM159A likely functions as a transmembrane adaptor protein like FAM159B, design experiments to investigate:

  • Protein-Protein Interactions: Use co-immunoprecipitation, proximity ligation assays, and FRET/BRET techniques to identify binding partners. Based on FAM159B studies, potential interaction partners may include various transmembrane receptors .

  • Signaling Pathway Analysis: Employ phosphoproteomic approaches to identify changes in cellular signaling upon FAM159A overexpression or knockdown. Monitor pathways related to receptor trafficking and signal transduction.

  • Domain Function Analysis: Create truncated constructs of FAM159A to identify functional domains. This is particularly important given the modular nature of adaptor proteins and their protein-protein interaction domains.

  • Cellular Localization Studies: Use subcellular fractionation and immunofluorescence microscopy to determine the precise localization of FAM159A, which may provide insights into its function.

The experimental design should include appropriate controls and consider potential species differences, as observed with FAM159B .

What methodologies are recommended for investigating species-specific differences in FAM159A expression and function?

Based on findings with FAM159B showing species differences in expression patterns, particularly in pancreatic islets , researchers should:

  • Comparative Expression Analysis: Perform parallel immunohistochemistry studies across human, rat, and mouse tissues using validated antibodies specific to FAM159A.

  • Cross-Species Functional Studies: Use heterologous expression systems to determine if mouse FAM159A can functionally substitute for human FAM159A in cellular assays.

  • Sequence-Function Relationship: Analyze species-specific sequence variations and their impact on protein function through site-directed mutagenesis.

  • Transcriptional Regulation Study: Investigate species differences in promoter regions and transcription factor binding sites that might explain differential expression patterns.

  • Pathophysiological Context: Examine FAM159A expression in disease models across species, similar to the diabetes studies conducted for FAM159B .

This multi-faceted approach will help elucidate whether findings in mouse models can be extrapolated to humans.

How can researchers effectively optimize recombinant FAM159A protein production and purification for functional studies?

For optimal recombinant mouse FAM159A production:

  • Expression System Selection: For membrane proteins like FAM159A, mammalian expression systems (HEK293, CHO cells) often provide better folding and post-translational modifications than bacterial systems. Consider insect cell systems for higher yields.

  • Construct Design:

    • Include appropriate tags (His, FLAG, etc.) for purification

    • Consider using fusion partners to enhance solubility

    • Remove the signal peptide if expressing the extracellular domain only

  • Purification Strategy:

    • Use detergent screening to identify optimal solubilization conditions

    • Implement a two-step purification process (affinity chromatography followed by size exclusion)

    • Consider nanodiscs or liposomes for maintaining native conformation

  • Quality Control:

    • Verify protein identity by mass spectrometry

    • Assess protein folding using circular dichroism

    • Confirm functionality through binding assays with known partners

  • Storage Optimization:

    • Determine optimal buffer conditions for protein stability

    • Test various cryoprotectants to prevent freeze-thaw damage

    • Validate long-term activity retention

What are the key considerations when designing quasi-experimental approaches for studying FAM159A function in disease models?

When true experimental designs with randomization aren't feasible in FAM159A research, quasi-experimental approaches offer viable alternatives :

  • Interrupted Time Series Design: Monitor FAM159A expression before and after disease onset in natural progression models.

  • Non-Equivalent Control Group Design: Compare FAM159A function between matched diseased and healthy tissues when randomization isn't possible.

  • Regression Discontinuity Design: Useful for studying FAM159A in developmental contexts where expression might change at specific developmental thresholds.

Key considerations include:

  • Internal Validity: Control for confounding variables through matching, statistical controls, and multiple baseline measurements

  • Selection Bias Mitigation: Use propensity score matching when selecting comparison groups

  • Statistical Analysis: Employ appropriate methods for non-randomized designs, such as difference-in-differences analysis

  • Replication: Validate findings across multiple models and systems

Remember that while quasi-experimental designs cannot establish causality with the same confidence as randomized experiments, they provide valuable insights when properly designed and interpreted .

How can researchers effectively apply eQTL analysis to understand FAM159A genetic regulation?

Expression Quantitative Trait Loci (eQTL) analysis can reveal genetic variants affecting FAM159A expression. Based on methodologies used in comprehensive eQTL studies :

  • Study Design Considerations:

    • Ensure adequate sample size (minimum 80-100 samples for cis-eQTL detection)

    • Account for population structure and batch effects

    • Consider tissue-specific expression patterns of FAM159A

  • Data Processing Pipeline:

    • Apply rigorous quality control for both genotype and expression data

    • Use appropriate normalization methods for expression data

    • Consider correcting for known cis-eQTL effects when searching for trans-eQTLs

  • Statistical Analysis:

    • Implement non-parametric correlation tests (Spearman's rank) for robust results

    • Apply appropriate multiple testing correction (FDR)

    • Use permutation testing to establish significance thresholds

  • Functional Validation:

    • Validate significant eQTLs using CRISPR-based approaches

    • Investigate chromatin interactions at eQTL loci

    • Examine transcription factor binding at significant variants

This approach will help identify genetic variants that influence FAM159A expression, potentially revealing regulatory mechanisms and disease associations.

What methodologies are recommended for investigating colocalization of FAM159A with other proteins in different cell types?

To rigorously investigate protein colocalization:

  • Immunofluorescence Techniques:

    • Use multi-color immunofluorescence with spectrally distinct fluorophores

    • Implement super-resolution microscopy (STED, STORM, PALM) for improved spatial resolution

    • Apply techniques similar to those used for FAM159B colocalization with hormones in pancreatic islets

  • Quantitative Colocalization Analysis:

    • Calculate Pearson's or Mander's coefficients for quantitative assessment

    • Implement object-based colocalization analysis for more accurate results

    • Use appropriate controls including single-labeled samples and antibody controls

  • In Situ Proximity Ligation Assay (PLA):

    • Detect protein-protein interactions with nanometer resolution

    • Provides higher specificity than conventional colocalization

    • Useful for confirming suspected interactions

  • Live Cell Imaging:

    • Use fluorescent protein fusions to monitor dynamic interactions

    • Implement FRET/FLIM to detect direct protein interactions

    • Consider photobleaching techniques (FRAP, FLIP) to assess interaction kinetics

  • Data Analysis and Reporting:

    • Report complete microscope settings and image acquisition parameters

    • Use unbiased automated analysis where possible

    • Present representative images alongside quantitative data

These approaches will provide robust evidence for FAM159A colocalization with potential binding partners across different cell types.

How might FAM159A function differ from FAM159B in neuroendocrine systems?

Based on the distinctive expression patterns observed for FAM159B across species , researchers investigating FAM159A should consider:

  • Functional Specialization: While FAM159B shows prominent expression in pancreatic islets with species-specific patterns of colocalization with hormones , FAM159A may have evolved specialized functions in other neuroendocrine tissues or signaling pathways.

  • Methodological Approach:

    • Compare expression patterns through parallel immunohistochemistry studies

    • Investigate differential effects on hormone secretion in appropriate cell models

    • Perform comparative interactome studies to identify unique binding partners

    • Use gene knockdown/knockout studies to identify non-redundant functions

  • Evolutionary Context: Analyze the evolutionary history of FAM159A and FAM159B to understand potential functional divergence. This may explain why vertebrates maintain two copies of these genes .

  • Disease Relevance: Examine differential expression in neuroendocrine tumors and metabolic disorders, as FAM159B has shown potential relevance to diabetes through its expression in pancreatic islets .

Understanding the specific roles of FAM159A will provide insights into its unique contributions to neuroendocrine function and potential as a therapeutic target.

What implications does the adaptor protein function of FAM159A have for designing targeted therapeutics?

As part of the Shisa-like protein family potentially functioning as a transmembrane adaptor , FAM159A presents unique considerations for therapeutic development:

  • Target Validation Strategy:

    • Identify specific signaling pathways modulated by FAM159A

    • Determine tissue specificity to minimize off-target effects

    • Establish disease relevance through altered expression or function studies

  • Therapeutic Modalities:

    • Small molecule inhibitors targeting protein-protein interactions

    • Peptide mimetics that compete for binding interfaces

    • Antibody-based approaches for extracellular domains

    • RNA-based therapeutics for expression modulation

  • Screening Systems:

    • Develop cell-based assays measuring downstream signaling outcomes

    • Implement protein-fragment complementation assays for interaction screening

    • Consider phenotypic screening approaches in disease-relevant models

  • Translational Considerations:

    • Address species differences in FAM159A function and expression

    • Evaluate potential redundancy with FAM159B

    • Develop appropriate biomarkers for target engagement

This systematic approach will help overcome the challenges inherent in targeting adaptor proteins like FAM159A.

How should researchers approach data contradictions when comparing FAM159A expression across different experimental platforms?

When confronting contradictory FAM159A expression data:

  • Systematic Evaluation of Methodological Differences:

    • Compare antibody specificity and validation methods

    • Evaluate primer design and specificity for RNA-based methods

    • Assess cell/tissue preparation protocols that might affect protein detection

    • Consider detection sensitivity limits of different platforms

  • Statistical Approach:

    • Implement meta-analysis techniques to integrate findings

    • Use appropriate normalization methods when comparing across platforms

    • Consider Bayesian approaches to weigh evidence based on methodological rigor

  • Biological Factors to Consider:

    • Evaluate temporal expression changes during development or disease progression

    • Assess potential post-translational modifications affecting detection

    • Consider sub-cellular localization differences affecting extraction efficiency

    • Examine potential splice variants with different expression patterns

  • Resolution Strategy:

    • Design validation experiments specifically addressing contradictions

    • Use orthogonal methods to verify key findings

    • Consider single-cell approaches to address cellular heterogeneity

This systematic approach helps resolve apparent contradictions that may reflect biological complexity rather than experimental error.

What statistical approaches are recommended for analyzing FAM159A expression changes in experimental conditions?

For robust statistical analysis of FAM159A expression:

  • Experimental Design Considerations:

    • Perform power analysis to determine appropriate sample size

    • Plan for adequate biological and technical replicates

    • Implement appropriate randomization and blinding procedures

    • Consider time course studies for dynamic expression changes

  • Statistical Method Selection:

    Experimental ScenarioRecommended Statistical ApproachConsiderations
    Two-group comparisont-test (parametric) or Mann-Whitney U test (non-parametric) Verify normality assumptions
    Multiple group comparisonANOVA with appropriate post-hoc testsTest for homogeneity of variance
    Repeated measuresRepeated measures ANOVA or mixed modelsAccount for within-subject correlation
    Correlation analysisPearson's or Spearman's correlation Select based on data distribution
    Classification tasksMachine learning approaches (SVM, Random Forest)Important for biomarker development
  • Advanced Considerations:

    • Apply appropriate multiple testing corrections (Bonferroni, FDR)

    • Consider Bayesian approaches for small sample sizes

    • Implement robust statistical methods resistant to outliers

    • Use specialized methods for high-dimensional data (RNA-seq, proteomics)

  • Reporting Standards:

    • Include complete statistical details (test used, exact p-values)

    • Report effect sizes alongside significance tests

    • Provide confidence intervals where appropriate

    • Present data visualizations that accurately represent the findings

Following these guidelines ensures rigorous analysis and interpretation of FAM159A expression data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.