Recombinant Mouse Membrane protein FAM159B (Fam159b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Shisal2b; Fam159b; Protein shisa-like-2B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Shisal2b
Target Protein Sequence
MSQSSRLCSGYYSLNRSFVEPFQCPQRGDGAALLYCCGFADLKYCCSEPGSYFPYKHSYM WSLSIGALVGLGIAALVLLAFVISVCVLCYLFLYTKPQRLDNGLKLQHLETSSTLEGNIN RKAKGLNAVSNSTNETFYEADDGTQEKTMDITQINIAC
Uniprot No.

Target Background

Database Links
Protein Families
Shisa family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FAM159B and where is it expressed in mice?

FAM159B is an adaptor protein belonging to the Shisa-like protein family. In mice, FAM159B expression is prominently observed in neuronal and neuroendocrine cells and tissues. Specifically, FAM159B shows strong expression in the cerebral cortex (particularly in pyramidal cells), trigeminal ganglia, dorsal root ganglia, and select cells in pancreatic islets. Additionally, expression is detected in bronchial epithelia, neuroendocrine cells of the gastrointestinal tract, and certain immune cells such as macrophages .

Unlike its human counterpart, mouse FAM159B expression in pancreatic islets is restricted to single cells located on the outer edges of the islets, showing complete colocalization with somatostatin-secreting δ-cells but no overlap with insulin or glucagon expression .

How does FAM159B expression in mice compare to other species?

Immunohistochemical analysis reveals both similarities and significant differences in FAM159B expression patterns across species:

Tissue/Cell TypeMouse FAM159BRat FAM159BHuman FAM159B
Cortical pyramidal cellsPresentPresentPresent
Trigeminal and dorsal root gangliaStrong expressionStrong expressionLower expression
Pancreatic isletsLimited to single cells on outer edges (δ-cells)Limited to single cells on outer edges (δ-cells)Distributed throughout entire islets
KidneyPresent in mesangial cells and tubulesPresent in mesangial cells and tubulesStrong in mesangial cells, Bowman's capsule layers, variable in tubules
Adrenal cortexPronounced stainingModerate stainingModerate staining
Pituitary glandLow expressionDistinct expressionLow expression

The most striking species difference occurs in pancreatic islets, where FAM159B shows complete colocalization with somatostatin in mice and rats but partially overlaps with insulin, glucagon, and somatostatin in humans .

What experimental methods are used to study FAM159B expression in mice?

The primary method for studying FAM159B expression is immunohistochemistry using specific antibodies. For mice, researchers commonly use:

  • Conventional immunohistochemistry: Using anti-FAM159B antibodies (e.g., HPA011778) to detect the protein in tissue sections, with appropriate controls such as antibody preadsorption with the immunizing peptide to verify specificity .

  • Immunohistochemical double-labeling: To evaluate colocalization with other markers, particularly pancreatic hormones (insulin, glucagon, somatostatin) in islet cells .

  • Quantitative image analysis: To measure total islet area, area occupied by FAM159B-positive cells, and their relative proportions in different experimental conditions .

For recombinant mouse FAM159B studies, high-throughput approaches may be employed, including various expression systems, cloning methods, and purification strategies appropriate for membrane proteins .

What are the optimal expression systems for producing recombinant mouse FAM159B?

As a membrane protein, FAM159B presents challenges for recombinant production. While no specific expression system has been definitively established as optimal for mouse FAM159B, general principles for membrane protein expression can be applied:

For mouse FAM159B specifically, testing multiple expression systems in parallel is recommended, with construct screening incorporating different fusion tags and solubilization conditions to identify optimal production parameters .

How should experimental controls be designed when studying FAM159B function in mouse models?

When designing experiments to study FAM159B function in mice, careful consideration of experimental variables and controls is essential:

  • Independent variable definition: Clearly define the manipulation targeting FAM159B (e.g., genetic knockout, overexpression, specific mutations) .

  • Dependent variable selection: Choose appropriate outcome measures relevant to FAM159B's suspected functions in neuroendocrine signaling or pancreatic islet function .

  • Critical controls:

    • Antibody specificity controls: When using anti-FAM159B antibodies, include preadsorption controls with the immunizing peptide to confirm specificity in mouse tissues .

    • Genetic background controls: Match experimental and control animals for genetic background, age, and sex.

    • Compensation controls: Consider potential compensatory upregulation of FAM159A or other Shisa-family proteins.

  • Tissue-specific considerations: Given FAM159B's restricted expression pattern in mouse pancreatic islets (limited to δ-cells), pancreatic function studies should include comprehensive hormone profiling (insulin, glucagon, somatostatin) and carefully designed glucose tolerance tests .

  • Cross-species validation: Due to significant differences in FAM159B expression patterns between mice and humans, findings in mouse models should be interpreted cautiously when extrapolating to human physiology .

What are the methodological challenges in isolating functional recombinant mouse FAM159B?

As a membrane protein, mouse FAM159B presents several methodological challenges:

  • Expression yield optimization:

    • Screening multiple constructs with varied N- and C-terminal boundaries

    • Testing different fusion tags (His, GST, MBP) to enhance solubility and expression

    • Optimizing expression temperature, induction conditions, and culture media

  • Membrane extraction and solubilization:

    • Selection of appropriate detergents that maintain protein structure and function

    • Evaluation of detergent-lipid mixtures or nanodiscs for stabilization

    • Consideration of amphipol or styrene maleic acid copolymer (SMA) approaches

  • Functional assessment challenges:

    • Developing assays to confirm proper folding and function of recombinant FAM159B

    • Verifying interaction with known or predicted binding partners

    • Assessing membrane integration and topology

  • Purification strategy:

    • Implementing multi-step purification to achieve high purity

    • Monitoring protein stability throughout the purification process

    • Careful selection of buffer conditions to maintain solubility and prevent aggregation

High-throughput approaches are recommended, screening multiple parameters in parallel to identify optimal conditions for expressing functional mouse FAM159B .

How do metabolic conditions affect FAM159B expression in mouse pancreatic islets?

Research on Zucker rats provides insight into how metabolic conditions might affect FAM159B expression in rodent pancreatic islets, which may be relevant to mouse models:

This suggests that metabolic conditions affecting insulin demand and islet morphology may indirectly impact FAM159B-expressing cells, although the proportion of these cells relative to the expanded islet area decreases in diabetic conditions .

ParameterLean Control RatsObese Control RatsStatistical Significance
Islet area (% of pancreas)LowerHigherp<0.001
FAM159B+ area (% of islet)HigherLowerp<0.001
FAM159B+ area (% of total pancreas)LowerHigherp<0.001

These findings from rat models suggest that mouse studies should carefully control for and evaluate metabolic status when studying FAM159B expression in pancreatic islets .

What cloning strategies are most effective for recombinant mouse FAM159B production?

For recombinant mouse FAM159B production, several cloning strategies can be considered:

  • Recommended approaches:

    • Ligation-Independent Cloning (LIC): Methods such as In-Fusion or Gibson assembly are particularly reliable for membrane protein constructs, utilizing large single-strand overhangs for targeted insertion without introducing unwanted amino acids .

    • Recombination-based systems: While Gateway cloning allows parallel construction from multiple fragments, it results in vector-derived amino acid additions that could potentially affect membrane protein function .

  • Vector selection:

    • The pOPIN vector system is advantageous as it supports screening in multiple expression hosts and accommodates various fusion tags .

    • Consider vectors with inducible promoters to control expression levels, which can be critical for membrane proteins that may be toxic when overexpressed.

  • Construct design considerations:

    • Generate multiple constructs with different boundaries and tag positions

    • Consider removing predicted disordered regions that might interfere with folding

    • Include fusion partners known to enhance membrane protein expression (e.g., GFP, MBP)

    • Design constructs both with and without predicted signal sequences

High-throughput cloning is essential to efficiently generate the construct diversity needed to identify optimal expression conditions for mouse FAM159B .

How can species-specific differences in FAM159B be leveraged in experimental design?

The notable differences in FAM159B expression between mice, rats, and humans present both challenges and opportunities for research:

  • Comparative biology approaches:

    • Design experiments that directly compare FAM159B function across species to elucidate evolutionarily conserved versus species-specific roles

    • Use the restricted expression of FAM159B in mouse pancreatic islets (δ-cells only) versus broader expression in human islets to investigate cell-type specific functions

  • Mechanistic investigations:

    • Explore the molecular basis for different expression patterns through promoter analysis, transcription factor binding studies, and epigenetic profiling

    • Investigate whether species differences in FAM159B localization correlate with differences in islet architecture or glucose regulation mechanisms

  • Translational considerations:

    • Explicitly test whether findings regarding FAM159B function in mice can be extrapolated to humans

    • Design parallel experiments in mouse and human systems when investigating FAM159B's role in diseases such as diabetes

  • Methodological advantages:

    • The consistent colocalization of FAM159B with somatostatin in mouse islets provides a reliable marker for δ-cells

    • The more restricted expression pattern in mice may facilitate cleaner phenotypic analysis in knockout studies

These species differences underscore the importance of careful experimental design and cautious interpretation when using mouse models to study FAM159B .

What purification strategies are most suitable for recombinant mouse FAM159B?

Purifying membrane proteins like mouse FAM159B requires specialized approaches:

  • Initial extraction and solubilization:

    • Screen multiple detergents (DDM, LMNG, CHAPS, etc.) for optimal solubilization

    • Test detergent concentration gradients to find minimum effective concentration

    • Consider nanodiscs or membrane mimetics for maintaining native-like environment

  • Affinity purification:

    • Leverage fusion tags (His, FLAG, Strep) for initial capture

    • For multi-tag constructs, sequential affinity steps can significantly increase purity

    • Monitor protein stability and activity throughout purification

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography as needed for higher purity

    • Consider on-column detergent exchange during purification

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Thermal stability assays to assess protein folding

    • Analytical size exclusion to evaluate monodispersity

    • Functional assays based on known or predicted activities

  • Scale-up considerations:

    • Systematically optimize each step at small scale before scaling up

    • Monitor yield and quality at each purification stage

    • Evaluate stability during concentration and storage

High-throughput screening approaches can rapidly identify optimal conditions by testing multiple parameters in parallel, which is particularly valuable for challenging membrane proteins like FAM159B .

How can FAM159B expression patterns inform diabetes research in mouse models?

The distinct expression pattern of FAM159B in mouse pancreatic islets offers unique insights for diabetes research:

  • δ-cell specific marker: The exclusive expression of FAM159B in somatostatin-producing δ-cells in mice makes it a valuable marker for tracking changes in this cell population during diabetes progression .

  • Comparative islet biology: Studies in Zucker rats revealed that diabetic conditions are associated with:

    • Increased total islet area, reflecting β-cell expansion

    • Decreased proportion of FAM159B-positive cells relative to total islet area

    • Increased absolute area of FAM159B-positive cells in the pancreas

This suggests complex remodeling of islet cell populations during diabetes development, with differential effects on different cell types.

  • Experimental approaches:

    • Use FAM159B as a δ-cell marker in lineage tracing studies

    • Monitor changes in FAM159B-expressing cells in various diabetic mouse models

    • Investigate potential functional roles of FAM159B in regulating somatostatin release and paracrine signaling within islets

  • Translational limitations: Researchers must consider that the restricted expression of FAM159B to δ-cells in mice differs from the broader expression across islet cell types in humans, potentially limiting direct translational relevance .

What analytical techniques are most effective for characterizing mouse FAM159B structure-function relationships?

To elucidate structure-function relationships of mouse FAM159B, several complementary approaches should be considered:

  • Structural analysis techniques:

    • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins, requiring approximately 10-20 μg per grid

    • X-ray crystallography: If crystals can be obtained, typically requiring 100-250 μg of purified protein per crystallization plate

    • Nuclear Magnetic Resonance (NMR): For analyzing specific domains or protein-protein interactions

  • Functional characterization:

    • Binding assays: To identify interaction partners and quantify binding affinities

    • Cell-based functional assays: Leveraging the known expression pattern in specific cell types

    • Electrophysiology: If FAM159B affects membrane properties or channel functions

  • Domain mapping approaches:

    • Systematic truncation analysis to identify functional domains

    • Mutagenesis of conserved residues to assess their importance

    • Chimeric proteins swapping domains between mouse and human FAM159B to understand species differences

  • In silico analysis:

    • Molecular dynamics simulations of membrane integration

    • Sequence conservation analysis across species

    • Structure prediction using modern AI-based approaches

  • Integrative approaches:

    • Combining structural data with functional outcomes

    • Correlating domain function with cellular localization

    • Mapping interaction interfaces with binding partners

These techniques together can provide comprehensive insights into how FAM159B structure relates to its function, particularly in the context of its role in neuroendocrine cells and pancreatic islets .

What considerations are important when designing gene knockout or knockdown studies for mouse FAM159B?

When designing gene modification studies for mouse FAM159B, several important considerations should guide experimental planning:

  • Target specificity:

    • Ensure specificity for FAM159B without affecting the paralogous FAM159A

    • For CRISPR-Cas9 approaches, carefully design guide RNAs to minimize off-target effects

    • For RNAi approaches, validate knockdown specificity with multiple independent siRNAs or shRNAs

  • Expression pattern considerations:

    • Given FAM159B's restricted expression pattern in mice (primarily in neuronal, neuroendocrine tissues, and δ-cells in pancreatic islets), phenotype assessment should focus on these specific cell types

    • Consider conditional knockout approaches targeting specific cell types (e.g., somatostatin-producing cells)

  • Phenotypic analysis strategy:

    • Comprehensive assessment of pancreatic islet morphology and hormone expression

    • Evaluation of glucose homeostasis and hormone secretion dynamics

    • Analysis of neuronal and neuroendocrine function in relevant tissues

    • Consider age-dependent phenotypes, as FAM159B may have developmental roles

  • Control considerations:

    • Include appropriate wild-type controls matched for genetic background, age, and sex

    • Consider heterozygous animals to assess gene dosage effects

    • For inducible systems, include non-induced transgenic controls

  • Potential compensation mechanisms:

    • Assess potential upregulation of FAM159A or other Shisa-family proteins

    • Consider acute (knockdown) versus chronic (knockout) approaches to minimize compensation

    • Validate findings with complementary approaches (e.g., follow knockout studies with rescue experiments)

  • Translational limitations:

    • Acknowledge that findings in mice may not directly translate to humans due to different expression patterns

    • Consider parallel studies in human cell models where appropriate

Well-designed gene modification studies should incorporate these considerations to maximize the validity and interpretability of results while minimizing confounding factors.

What emerging technologies could advance mouse FAM159B research?

Several emerging technologies hold promise for advancing research on mouse FAM159B:

  • Advanced imaging technologies:

    • Super-resolution microscopy: To precisely localize FAM159B within subcellular compartments

    • Expansion microscopy: For enhanced visualization of FAM159B distribution in tissues

    • Intravital imaging: To study FAM159B dynamics in live animals

  • Single-cell technologies:

    • Single-cell RNA sequencing: To identify transcriptional signatures in FAM159B-expressing cells

    • Single-cell proteomics: To characterize protein interaction networks

    • Spatial transcriptomics: To map FAM159B expression in tissue context with molecular resolution

  • Genome editing advances:

    • Prime editing: For precise modification of FAM159B with reduced off-target effects

    • Base editing: For introducing specific point mutations to study structure-function relationships

    • In vivo CRISPR screening: To identify FAM159B functional domains and interaction partners

  • Protein technology innovations:

    • AlphaFold and structure prediction: To generate structural models for guiding experimental design

    • Cryogenic electron tomography: For visualizing FAM159B in its native membrane environment

    • Nanobody development: For highly specific detection and manipulation of FAM159B

  • Functional screening approaches:

    • Optogenetic control: For temporal manipulation of FAM159B-expressing cells

    • Chemogenetic approaches: For controlled activation/inhibition of specific pathways

    • Organoid technologies: For studying FAM159B function in complex tissue environments

These technologies could significantly enhance our understanding of FAM159B's localization, interactions, and functional roles in mouse models, potentially bridging the gap between mouse studies and human applications.

How might integrated multi-omics approaches advance understanding of mouse FAM159B function?

Integrated multi-omics approaches offer powerful strategies for comprehensively understanding mouse FAM159B function:

  • Combined transcriptomic and proteomic analysis:

    • Correlate FAM159B expression with global gene expression patterns

    • Identify co-regulated genes and proteins that may function in common pathways

    • Compare transcriptional and translational regulation across different physiological states

  • Interactome mapping:

    • Proximity labeling approaches (BioID, APEX) to identify proteins physically near FAM159B

    • Affinity purification coupled with mass spectrometry to identify stable interaction partners

    • Cross-linking mass spectrometry to capture transient interactions

  • Functional genomics integration:

    • CRISPR screens to identify genes that modify FAM159B-dependent phenotypes

    • Correlation of genetic variants with FAM159B expression or function

    • Epigenomic profiling to understand regulatory mechanisms controlling FAM159B expression

  • Metabolomic connections:

    • Assess metabolic changes in FAM159B-manipulated systems

    • Correlate FAM159B expression with metabolic states, particularly in pancreatic islets

    • Investigate potential roles in hormone secretion and glucose metabolism

  • Comparative multi-omics:

    • Compare multi-omic profiles between species (mouse, rat, human) to understand conserved versus divergent functions

    • Analyze data from normal versus disease models to identify pathologically relevant changes

    • Integrate findings across multiple tissues where FAM159B is expressed

  • Computational integration:

    • Network analysis to position FAM159B within cellular signaling pathways

    • Machine learning approaches to predict functional outcomes based on multi-omic signatures

    • Systems biology modeling to understand dynamic responses involving FAM159B

These integrated approaches can provide a holistic view of FAM159B function that single-technique approaches cannot achieve, potentially revealing unexpected roles and connections.

What are the implications of species differences in FAM159B expression for translational research?

The significant differences in FAM159B expression patterns between mice and humans have important implications for translational research:

  • Cautious extrapolation of functional findings:

    • The restricted expression of FAM159B to δ-cells in mouse pancreatic islets versus broader expression across islet cell types in humans suggests potentially different functional roles

    • Findings regarding FAM159B's impact on glucose homeostasis in mice may not directly translate to humans

  • Model selection considerations:

    • For certain research questions, rat models may be equally limited as mouse models

    • Consider complementary approaches using human cell lines, organoids, or tissue samples

    • Humanized mouse models expressing human FAM159B might provide more translational insights

  • Biomarker development challenges:

    • FAM159B's potential as a biomarker for neuroendocrine conditions may differ between species

    • Validation studies must account for species-specific expression patterns and functions

  • Therapeutic target assessment:

    • Targeting FAM159B for therapeutic purposes requires careful evaluation of species differences

    • Drug screening should include both rodent and human FAM159B to identify species-specific effects

  • Research strategy recommendations:

    • Design parallel studies in rodent models and human systems

    • Explicitly test whether mechanisms identified in mice operate similarly in human tissues

    • Focus on evolutionarily conserved aspects of FAM159B function

  • Opportunity for comparative biology:

    • Species differences offer unique opportunities to understand evolutionary adaptations in neuroendocrine systems

    • Comparative approaches may reveal fundamental principles about islet biology and glucose regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.