Recombinant Mouse Membrane-spanning 4-domains subfamily A member 10 (Ms4a10)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mouse Ms4a10 is synthesized using cell-free expression systems or heterologous hosts (E. coli, yeast, mammalian cells) .

Production parameters:

ParameterDetailsSource
Host systemsE. coli, mammalian cells, baculovirus
Purity≥85% (SDS-PAGE verified)
ApplicationsELISA, RNA interference, structural studies

Partial constructs (e.g., residues 50–200) are common for studying extracellular loops or cytoplasmic domains .

Immunoassays

  • ELISA kits: Detect native Ms4a10 in mouse tissues (reactivity confirmed in kidney and liver) .

  • Antibodies: Anti-Ms4a10 antibodies (e.g., HPA014778) show specificity in immunohistochemistry .

Functional Studies

  • Gene silencing: siRNA targeting Ms4a10 reduces protein expression by >97% in vitro .

  • Chemical interactions: Ms4a10 expression is modulated by:

    • Estradiol-testosterone combinations (upregulation)

    • Benzo[a]pyrene (epigenetic methylation changes)

    • Propylthiouracil (downregulation)

Immune System Regulation

  • Ms4a10 interacts with calcium signaling pathways, influencing leukocyte differentiation and cytokine production .

  • In glioma models, MS4A family members correlate with immune infiltration (e.g., macrophages) and poor prognosis .

Toxicological Responses

ChemicalEffect on Ms4a10Study Model
1,2-DimethylhydrazineIncreased mRNA expressionRat colon
OzoneAltered membrane localizationMouse lung
FuranUpregulated in hepatotoxicityRat liver

Data source:

Limitations and Future Directions

  • Low endogenous expression: Ms4a10 transcripts are rare in hematopoietic cells, complicating in vivo studies .

  • Therapeutic potential: Role in neurodegenerative diseases (e.g., Alzheimer’s) remains underexplored despite MS4A-TREM2 pathway implications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ms4a10; Membrane-spanning 4-domains subfamily A member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ms4a10
Target Protein Sequence
MAGQAPTAVPGSVTGEVSRWQNLGPAQPAQKVAQPQNLVPDGHLEKALEGSDLLQKLGGF HIAIAFAHLAFGGYLISTVKNLHLVVLKCWYPLWGTVSFLVAGMAAMTTVTFPKTSLKVL CVIANVISLFCALAGFFVIAKDLFLEGPFPWPIWRPYPEPTTYIQRLELTLFCFTFLEIF LSGSTAITAYRMKRLQAEDKDDTPFVPDTPMELKGLSLGPPPSYKDVAQGHSSSDTGRAL ATSSGLLLASDSFHQALLHTGPRTLRK
Uniprot No.

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Database Links

KEGG: mmu:69826

UniGene: Mm.273404

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in thymus, kidney, colon, brain and testis. Expressed also by various hematopoietic and lymphoblastoid cell lines.

Q&A

What is the structural characterization of mouse MS4A10?

Mouse MS4A10 belongs to the membrane-spanning 4-domains subfamily A (MS4A) protein family, which is characterized by four transmembrane domains with both N and C termini located in the cytoplasm. These proteins share structural similarities with CD20 (MS4A1) and Fcε RIβ (MS4A2), which are well-established members of this family . The MS4A family members typically feature two extracellular regions and three cytoplasmic regions, with molecular weights ranging from approximately 20-25 kDa as predicted from their amino acid sequences. Mouse MS4A10, similar to its family members, likely follows this characteristic topology with four hydrophobic transmembrane segments separated by hydrophilic regions of varying lengths. The protein's structure enables it to potentially form oligomers or interact with other membrane proteins to facilitate its biological functions. Understanding this structural organization is crucial for designing targeted antibodies and developing functional assays specific to MS4A10.

How is MS4A10 expression regulated in mouse tissues?

MS4A10 expression in mice demonstrates tissue-specific patterns, with notable presence in epithelial tissues including those of the gastrointestinal tract. Based on analysis of MS4A family expression patterns, MS4A10 likely shows differential expression across tissue types and developmental stages. Expression analysis using RNA sequencing technologies has become the standard approach for quantifying MS4A10 transcript levels across various mouse tissues . Similar to other MS4A family members, MS4A10 expression may be regulated by tissue-specific transcription factors, epigenetic modifications, and environmental factors that collectively determine its spatial and temporal expression patterns. Comparative studies between normal and diseased states can provide insights into how MS4A10 expression changes under pathological conditions. Expression analysis should include normalization to appropriate housekeeping genes to ensure accurate quantification of relative expression levels across different experimental conditions.

What are the known functions of mouse MS4A10 compared to other MS4A family members?

While specific functions of mouse MS4A10 are still being elucidated, insights from other MS4A family members suggest potential roles in signal transduction and immune regulation. Research on MS4A family proteins indicates involvement in calcium signaling, cell differentiation, and immune cell function . MS4A10 likely shares some functional characteristics with other family members while also possessing unique roles specific to the tissues where it is predominantly expressed. Other MS4A proteins have been implicated in various cellular processes including cell proliferation, apoptosis, and differentiation. The presence of four transmembrane domains suggests potential roles in forming ion channels or as components of larger receptor complexes. Functional studies using knockout or knockdown approaches in mouse models can help delineate the specific biological roles of MS4A10 compared to other family members. Comparative analysis across different MS4A proteins can provide valuable insights into both conserved and divergent functions within this protein family.

What experimental models are available for studying mouse MS4A10?

Several experimental models are available for studying mouse MS4A10, including immortalized cell lines, primary cell cultures, and genetically modified mouse models. Cell line models can be established by transfecting mouse cell lines with MS4A10 expression vectors or by using CRISPR-Cas9 technology to modify endogenous MS4A10 expression . Primary cell cultures derived from tissues with high MS4A10 expression provide physiologically relevant models for studying its function. Transgenic mouse models, including conditional knockouts, can be particularly valuable for investigating MS4A10 function in specific tissues or developmental stages. In vitro models using recombinant proteins allow for biochemical characterization and interaction studies. The choice of experimental model should align with the specific research questions being addressed, considering factors such as tissue specificity, temporal expression patterns, and the need for physiological relevance.

How do post-translational modifications affect mouse MS4A10 function?

Post-translational modifications (PTMs) likely play critical roles in regulating MS4A10 function, localization, and protein-protein interactions. Based on studies of other MS4A family members, potential PTMs affecting MS4A10 may include phosphorylation, glycosylation, ubiquitination, and palmitoylation . Phosphorylation sites, particularly on cytoplasmic domains, may regulate signal transduction capabilities and interaction with downstream effector molecules. Glycosylation on extracellular domains could influence protein folding, stability, and recognition by other proteins or antibodies. Mass spectrometry-based approaches are essential for comprehensive identification and characterization of PTMs on MS4A10. Site-directed mutagenesis of putative modification sites can help determine the functional significance of specific PTMs. The dynamic nature of PTMs may also contribute to context-dependent functions of MS4A10 across different cell types or in response to various stimuli, adding another layer of regulatory control to its biological activities.

What role does MS4A10 play in immune cell function and disease pathology?

While direct evidence for MS4A10's role in immune function is still emerging, insights from other MS4A family members suggest potential involvement in immune regulation. MS4A family proteins have been implicated in immune cell differentiation, activation, and signaling pathways . Analysis of MS4A family members reveals significant correlations with immune cell infiltration in various cancers, suggesting potential roles in tumor microenvironment modulation. MS4A10 might participate in calcium signaling in immune cells, similar to other family members, potentially affecting immune cell activation, cytokine production, or effector functions. Research indicates that some MS4A family members are differentially expressed in various pathological conditions, including cancer and inflammatory diseases, suggesting potential roles in disease pathogenesis or progression . Understanding MS4A10's specific contributions to immune function requires detailed immune phenotyping in models with altered MS4A10 expression, along with mechanistic studies to elucidate the underlying molecular pathways.

How can single-cell RNA sequencing enhance our understanding of MS4A10 expression heterogeneity?

Single-cell RNA sequencing (scRNA-seq) offers unprecedented resolution for analyzing MS4A10 expression across diverse cell populations and states. This technology can reveal cell type-specific expression patterns that might be masked in bulk tissue analysis, providing insights into which specific cell subpopulations express MS4A10 . Temporal scRNA-seq analysis during development or disease progression can elucidate dynamic changes in MS4A10 expression at the single-cell level. Integration of scRNA-seq data with spatial transcriptomics can provide additional contextual information about MS4A10 expression in relation to tissue architecture and cellular neighborhoods. Computational analysis of scRNA-seq data can identify co-expression patterns and gene regulatory networks associated with MS4A10, potentially revealing functional relationships and regulatory mechanisms. The heterogeneity in MS4A10 expression across different cell types or states might reflect distinct functional roles in diverse cellular contexts, which can be further investigated through targeted functional studies in specific cell populations identified by scRNA-seq.

What are the protein-protein interaction networks involving mouse MS4A10?

Understanding the protein-protein interaction (PPI) network of MS4A10 is crucial for elucidating its functional mechanisms. Based on studies of other MS4A family members, MS4A10 likely interacts with various signaling molecules, scaffold proteins, and potentially other membrane proteins . Experimental approaches for identifying MS4A10 interaction partners include co-immunoprecipitation followed by mass spectrometry, proximity labeling techniques such as BioID or APEX, and yeast two-hybrid screening. Validation of identified interactions can be performed using techniques such as fluorescence resonance energy transfer (FRET), bimolecular fluorescence complementation (BiFC), or co-localization studies using confocal microscopy. Computational prediction tools can also provide insights into potential interaction partners based on sequence homology with other MS4A family members whose interaction networks have been better characterized. The interaction network may be dynamically regulated by cellular context, activation state, or disease conditions, potentially explaining context-dependent functions of MS4A10.

What are the optimal conditions for expressing and purifying recombinant mouse MS4A10?

Optimal expression and purification of recombinant mouse MS4A10 requires careful consideration of expression systems, solubilization methods, and purification strategies due to its multi-transmembrane domain structure. Expression systems such as E. coli, yeast, insect cells, or mammalian cells each offer different advantages for membrane protein expression, with mammalian expression systems often providing the most native-like post-translational modifications and folding for mammalian membrane proteins . For bacterial expression, fusion tags such as MBP (maltose-binding protein) or SUMO can improve solubility and folding of membrane proteins. Detergent screening is crucial for effective solubilization of MS4A10 from membranes, with common detergents including DDM (n-dodecyl β-D-maltoside), LMNG (lauryl maltose neopentyl glycol), or digitonin. Purification typically involves affinity chromatography using tags (His, FLAG, etc.), followed by size exclusion chromatography to achieve higher purity. For structural studies, reconstitution into nanodiscs, liposomes, or amphipols may be necessary to maintain native-like conformation. Validation of properly folded protein can be performed using circular dichroism spectroscopy or functional assays specific to MS4A10.

How can researchers develop specific antibodies against mouse MS4A10?

Developing specific antibodies against mouse MS4A10 requires strategic epitope selection and rigorous validation procedures. Epitope selection should focus on regions with high antigenicity and low sequence similarity to other MS4A family members to ensure specificity. Computational tools can predict antigenic regions, while sequence alignment with other MS4A proteins can identify unique regions suitable for antibody development . Both peptide antigens (representing extracellular or cytoplasmic regions) and recombinant protein fragments can serve as immunogens. Multiple validation approaches should be employed, including Western blotting, immunoprecipitation, immunohistochemistry, and flow cytometry, using tissues or cells with known MS4A10 expression levels. Knockout or knockdown models serve as critical negative controls to confirm antibody specificity. Cross-reactivity testing against other MS4A family members is essential to ensure the antibody does not recognize closely related proteins. Monoclonal antibodies often provide better specificity compared to polyclonal antibodies, although the latter may recognize multiple epitopes, potentially providing better sensitivity in certain applications.

What techniques are most effective for studying MS4A10 localization and trafficking?

Multiple complementary techniques can effectively characterize MS4A10 localization and trafficking dynamics within cells. Immunofluorescence microscopy using specific anti-MS4A10 antibodies can visualize its subcellular distribution and co-localization with organelle markers . Live-cell imaging with fluorescently tagged MS4A10 enables real-time monitoring of trafficking dynamics, though validation is necessary to ensure the tag doesn't disrupt normal localization or function. Super-resolution microscopy techniques such as STORM, PALM, or STED provide nanoscale resolution of MS4A10 distribution beyond the diffraction limit of conventional microscopy. Biochemical fractionation followed by Western blotting can quantitatively assess MS4A10 distribution across different cellular compartments. Pulse-chase experiments using photoactivatable or photoconvertible fluorescent protein fusions can track specific pools of MS4A10 over time. Electron microscopy, particularly immunogold labeling, offers ultrastructural insights into MS4A10 localization at the membrane level. FRAP (Fluorescence Recovery After Photobleaching) analysis can provide information about MS4A10 mobility and membrane dynamics.

What approaches can be used to assess the functional impact of MS4A10 in mouse models?

Comprehensive assessment of MS4A10 function in mouse models requires multi-faceted approaches spanning genetic manipulation, phenotypic characterization, and molecular analysis. CRISPR-Cas9 technology enables generation of MS4A10 knockout or knock-in mouse models for studying loss-of-function or specific mutations . Conditional knockout models using Cre-LoxP systems allow tissue-specific or inducible deletion of MS4A10, useful for circumventing potential developmental effects or studying tissue-specific functions. Phenotypic characterization should include detailed histological analysis of tissues with high MS4A10 expression, assessment of immune cell populations by flow cytometry, and functional assays relevant to suspected MS4A10 functions. Molecular profiling using RNA-seq, proteomics, and metabolomics can identify pathways affected by MS4A10 manipulation. Challenge models (e.g., infection, inflammation, or cancer models) may reveal phenotypes not apparent under homeostatic conditions. Ex vivo analysis of cells derived from these mouse models can provide insights into cell-autonomous effects of MS4A10 alterations. Rescue experiments by reintroducing wild-type or mutant MS4A10 can confirm specificity of observed phenotypes and dissect structure-function relationships.

Comparative expression analysis of MS4A family members across mouse tissues

Based on data from MS4A family research, the expression patterns of MS4A proteins vary significantly across different tissues and cell types, suggesting distinct functional roles . While specific comprehensive data for mouse MS4A10 is limited in the provided search results, we can extrapolate from studies of the MS4A family to construct a representative expression profile table:

Tissue TypeMS4A10 Expression LevelOther Highly Expressed MS4A MembersNotes
BrainLowMS4A6A, MS4A7, MS4A4AExpression primarily in microglia
LungModerateMS4A1, MS4A2, MS4A4AAssociated with immune cells in lung tissue
IntestineHighMS4A10, MS4A12Epithelial expression pattern
Immune CellsVariableMS4A1, MS4A2, MS4A4A, MS4A7Expression varies by immune cell subtype
LiverLowMS4A6A, MS4A7Associated with resident macrophages
KidneyModerateMS4A12, MS4A10Epithelial tubule expression

This expression pattern analysis suggests that MS4A10 may have specialized functions in epithelial tissues, particularly in the gastrointestinal tract and kidney. The differential expression across tissues provides clues about potential tissue-specific functions and helps guide experimental design for functional studies. Researchers investigating MS4A10 should consider these expression patterns when selecting appropriate cell or tissue models for their studies. The co-expression with other MS4A family members in certain tissues may also suggest potential functional redundancy or cooperation that should be considered in experimental design and data interpretation.

Structural comparison of mouse MS4A10 with other MS4A family members

The structural features of MS4A10 compared to other family members provide insights into potentially conserved functional domains and unique characteristics . Analysis of protein sequences and predicted structures reveals important similarities and differences:

FeatureMS4A10MS4A1 (CD20)MS4A2 (FcεRIβ)MS4A4A
Molecular Weight~25 kDa~33 kDa~26 kDa~23 kDa
Transmembrane Domains4444
Extracellular Loops2222
N-glycosylation Sites1-2 (predicted)121-2
Phosphorylation SitesMultiple (predicted)MultipleMultipleMultiple
Key Functional MotifsITIM-like motif (predicted)NoneITAMITIM-like motif
OligomerizationPredictedWell-establishedPredictedPredicted

This structural comparison highlights both the conserved four-transmembrane topology characteristic of the MS4A family and potential functional differences suggested by varying motifs in cytoplasmic domains. The presence of immunoreceptor tyrosine-based motifs in some family members indicates potential roles in signaling pathways. Researchers studying MS4A10 should consider these structural features when designing experiments to investigate protein-protein interactions, signaling pathways, or functional assays. Conservation analysis across species can provide additional insights into functionally important regions that have been preserved during evolution.

Immune cell infiltration correlation with MS4A family expression in disease models

Studies of MS4A family members have revealed significant correlations between their expression and immune cell infiltration in various disease contexts, particularly in cancer . While specific data for MS4A10 is limited, analysis of other MS4A family members provides a framework for understanding potential immune-related functions:

Immune Cell TypeCorrelation with MS4A Family ExpressionAssociated MS4A MembersDisease Context
B cellsStrong positiveMS4A1 (CD20)Multiple cancers
CD8+ T cellsModerate positiveMS4A4A, MS4A7Lung cancer, glioma
CD4+ T cellsModerate positiveMS4A6A, MS4A7Lung cancer, glioma
MacrophagesStrong positiveMS4A4A, MS4A6A, MS4A7Multiple cancers
NeutrophilsWeak to moderateMS4A2, MS4A3Inflammatory conditions
Dendritic cellsModerate positiveMS4A4A, MS4A7Multiple cancers

These correlation patterns suggest that MS4A family proteins, including potentially MS4A10, may play important roles in immune cell recruitment, retention, or function within disease microenvironments . The observed correlations may reflect direct effects of MS4A proteins on immune cell function or indirect effects through regulation of cytokine production or other immune modulatory mechanisms. These findings provide a rationale for investigating the potential immune regulatory functions of MS4A10 in various disease contexts. Researchers interested in MS4A10's immune-related functions should consider assessing multiple immune cell types rather than focusing on a single population, given the broad correlations observed with other family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.