Recombinant Mouse Membrane-spanning 4-domains subfamily A member 15 (Ms4a15)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Ms4a15 localizes to the endoplasmic reticulum (ER) and regulates calcium (Ca²⁺) homeostasis and lipid metabolism:

FunctionMechanismImpact
Ferroptosis ResistanceDepletes ER luminal Ca²⁺ stores, reducing lipid peroxidation via altered phospholipid composition .Protects cells from iron-dependent oxidative death, critical in cancer survival .
Lipid RemodelingSuppresses polyunsaturated fatty acid (PUFA) synthesis, favoring shorter, saturated ether lipids .Reduces susceptibility to ferroptotic reactive oxygen species (ROS) .
Calcium SignalingInteracts with ER-resident Ca²⁺ regulators (e.g., IP3R1) to modulate Ca²⁺ flux .Alters downstream signaling pathways linked to cell migration and survival .

Ferroptosis Studies

  • Mechanistic Insights: Overexpression of Ms4a15 in murine fibroblasts confers resistance to ferroptosis inducers (e.g., RSL3, IKE) by reducing lipid ROS accumulation .

  • Therapeutic Relevance: High MS4A15 expression in lung adenocarcinoma correlates with poor prognosis, suggesting a target for sensitizing refractory cancers .

Lipidomics and Calcium Signaling

  • Lipid Profiling: MS4A15-expressing cells show decreased PUFA-containing phospholipids (e.g., arachidonic acid) and increased monounsaturated fatty acids (MUFAs) and plasmalogens .

  • Calcium Imaging: ER Ca²⁺ depletion by Ms4a15 disrupts IP3R1-mediated signaling, altering lipid droplet dynamics .

Experimental Tools

  • ELISA and Binding Assays: Used to quantify Ms4a15 in cell lysates and study protein-protein interactions .

  • 3D Spheroid Models: Demonstrates ferroptosis resistance in tumor-like microenvironments .

Ferroptosis Resistance Mechanism

  • Ms4a15 depletes ER Ca²⁺, inhibiting elongation/desaturation of fatty acids and promoting ferroptosis-resistant ether lipids .

  • Lipidomic analysis reveals a 40–60% reduction in PUFAs (e.g., C20:4, C22:6) and a 30% increase in MUFAs (e.g., C16:0, C18:0) .

Interaction Network

  • Co-regulated Genes: CLIC5, TNNC1, and SUSD2 (linked to Ca²⁺ signaling and adhesion) .

  • Pathways: PPAR signaling, arachidonic acid metabolism, and Ca²⁺-dependent migration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ms4a15; Membrane-spanning 4-domains subfamily A member 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ms4a15
Target Protein Sequence
MWERRGRGESAAGTAAVASRNASGLRPPPAILPTSMCQPPGIMQFEESQLGAQAPRATQP PDLRPMETFLTGEPKALGTVQILIGLIHLGFGSVLLMVRRGHLGMLFIEGGVPFWGGACF IISGSLSVAAERNHTSCLLKSSLGTNILSAMAAFAGTAILLMDFGVTNWDVGRGYLAVLT IFTILEFFIAVIATHFGCQATRAQTNASVIFLPNAFGTDFNIPSPAVSPPPAYDNVAYMP KESSE
Uniprot No.

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Database Links

KEGG: mmu:545279

UniGene: Mm.329729

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Ms4a15 and how does it relate to human MS4A15?

Ms4a15 belongs to the membrane-spanning 4-domains subfamily A (MS4A) protein family, characterized by four transmembrane domains. While human MS4A15 has been implicated in regulating biological processes such as iron removal, cell metabolism, and immune cell infiltration in cancer progression, mouse Ms4a15 likely serves similar functions with some species-specific variations .

Research methodology for comparative analysis:

  • Perform sequence homology analysis between mouse and human proteins using alignment tools (BLAST, Clustal Omega)

  • Conduct phylogenetic analysis of MS4A family members across species

  • Compare tissue-specific expression patterns using RNA-seq data from mouse and human tissues

  • Validate functional conservation through complementation studies in knockout models

What experimental approaches can effectively measure Ms4a15 expression in mouse tissues?

Based on human MS4A15 research methodologies, the following approaches are recommended for mouse Ms4a15:

  • RT-qPCR: Design mouse-specific primers targeting unique regions of Ms4a15 mRNA. Reference the methodology used for human MS4A15 where RT-qPCR validated expression differences between A549 and normal human bronchial epithelial cells .

  • RNA sequencing: Analyze differential expression across tissues using platforms similar to those employed for human studies (e.g., TCGA/GTEx approaches) .

  • Immunohistochemistry/Immunofluorescence: Use validated antibodies against mouse Ms4a15 for tissue localization.

  • Western blotting: Quantify protein levels across different tissues and experimental conditions.

For all methods, include appropriate housekeeping genes or proteins as internal controls, and validate across multiple mouse strains to account for strain-specific variations.

How can I validate antibodies for mouse Ms4a15 research?

Proper antibody validation is crucial for reliable Ms4a15 detection:

  • Specificity testing:

    • Use recombinant Ms4a15 protein as positive control

    • Include Ms4a15 knockout tissue as negative control

    • Test cross-reactivity with other MS4A family members

  • Validation methods:

    • Western blotting to confirm antibody detects protein of expected molecular weight

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence with competing peptide controls

    • Flow cytometry with appropriate controls

  • Multi-antibody approach: Use at least two antibodies targeting different epitopes of Ms4a15 to confirm findings.

What expression systems are recommended for recombinant Ms4a15 production?

For membrane proteins like Ms4a15, consider these expression systems:

  • Mammalian expression systems (HEK293, CHO cells):

    • Advantages: Proper folding, post-translational modifications

    • Methodology: Clone mouse Ms4a15 cDNA into vectors with strong promoters (CMV) and appropriate tags (His, FLAG)

    • Use inducible expression systems for temporal control

  • Baculovirus-insect cell system:

    • Advantages: Higher yield than mammalian systems, proper protein folding

    • Methodology: Generate recombinant baculovirus carrying Ms4a15 gene, infect Sf9 or Hi5 cells

  • Cell-free expression systems:

    • Advantages: Rapid production, suitable for membrane proteins

    • Methodology: Use wheat germ or rabbit reticulocyte lysate systems with detergents/nanodiscs

Table of expression system comparison:

Expression SystemAdvantagesDisadvantagesYieldPost-translational Modifications
Mammalian cellsNative-like folding, PTMsLower yield, costlyLow-mediumExcellent
Insect cellsHigher yield, proper foldingLess mammalian-like PTMsMedium-highGood
E. coliHighest yield, cost-effectivePoor for membrane proteinsVery highPoor
Cell-freeRapid, customizableExpensive reagentsLow-mediumLimited

How do I design primers for Ms4a15 detection and quantification?

For reliable Ms4a15 detection and quantification:

  • mRNA sequence analysis:

    • Obtain complete mouse Ms4a15 mRNA sequence from databases (NCBI, Ensembl)

    • Identify splice variants to ensure detection of all relevant isoforms

    • Check for sequence homology with other Ms4a family members to avoid cross-amplification

  • Primer design principles:

    • Length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature: 58-62°C with <2°C difference between pairs

    • Avoid secondary structures, primer-dimers, and repetitive sequences

    • Span exon-exon junctions to prevent genomic DNA amplification

  • Validation method:

    • Test primer efficiency using serial dilutions (efficiency should be 90-110%)

    • Verify amplicon by sequencing

    • Include no-template and reverse transcriptase-negative controls

    • Compare expression with established housekeeping genes (Gapdh, Actb, Hprt)

How might Ms4a15 function in mouse models of lung cancer, given human MS4A15's role?

Human MS4A15 has demonstrated prognostic value in lung adenocarcinoma, with lower expression correlating with poorer outcomes . For mouse studies:

  • Experimental approach:

    • Generate syngeneic mouse models with controlled Ms4a15 expression (overexpression/knockdown)

    • Use genetically engineered mouse models (GEMMs) that recapitulate lung adenocarcinoma (e.g., Kras^G12D/+;p53^fl/fl)

    • Measure tumor growth, metastasis, and survival outcomes

    • Monitor changes in pathological staging similar to human studies (where lower MS4A15 expression correlated with poorer pathologic stage)

  • Assessment methodology:

    • Track primary therapy outcomes using RECIST criteria adapted for mice

    • Apply ROC curve analysis to evaluate Ms4a15 as a biomarker, similar to the analysis performed for human MS4A15 (which showed an AUC of 0.863)

    • Conduct Kaplan-Meier survival analysis stratifying by Ms4a15 expression levels

  • Comparative analysis:

    • Correlate findings with human data to establish conserved mechanisms

    • Identify species-specific differences that might affect translational relevance

What methods would be effective for studying Ms4a15 interactions with immune cells in mice?

Human MS4A15 shows significant associations with various immune cell types, particularly mast cells, dendritic cells, and macrophages . To investigate similar interactions in mice:

  • Single-cell RNA sequencing (scRNA-seq):

    • Dissociate tumor and adjacent normal tissue from mouse models

    • Perform scRNA-seq to identify cell populations expressing Ms4a15

    • Analyze correlation between Ms4a15 expression and immune cell markers

  • Flow cytometry and cell sorting:

    • Design multi-parameter panels including Ms4a15 and immune cell markers

    • Use fluorescence-activated cell sorting (FACS) to isolate Ms4a15-expressing cells

    • Perform functional assays on sorted populations

  • Spatial transcriptomics/proteomics:

    • Apply techniques like Visium, MERFISH, or imaging mass cytometry

    • Map Ms4a15 expression relative to immune cell localization in tissue sections

    • Quantify spatial relationships between Ms4a15+ cells and immune infiltrates

  • Co-culture experiments:

    • Establish in vitro co-culture systems with Ms4a15-expressing cells and immune cells

    • Measure functional outcomes (cytokine production, proliferation, migration)

    • Use transwell systems to distinguish contact-dependent vs. secreted factors

How could Ms4a15 expression correlate with immune cell infiltration in mouse tumor models?

Based on human MS4A15 research showing positive correlations with mast cells, dendritic cells, and macrophages, and negative correlation with Th2 cells :

  • Experimental design:

    • Generate mouse tumor models with varying Ms4a15 expression levels

    • Collect tumor samples at different time points during progression

  • Analysis method:

    • Perform immunohistochemistry with multiplexed antibody panels

    • Quantify immune cell populations using flow cytometry

    • Apply gene set variation analysis (GSVA) similar to human studies

    • Calculate Spearman correlations between Ms4a15 expression and immune cell markers

  • Validation approach:

    • Conduct in vivo depletion studies of specific immune cell populations

    • Evaluate changes in Ms4a15 expression and tumor characteristics

    • Use bone marrow chimeras to distinguish effects of Ms4a15 in immune vs. non-immune cells

Expected correlation pattern based on human studies:

Immune Cell TypeExpected Correlation with Ms4a15Suggested Markers for Detection
Mast cellsStrong positivec-Kit, FcεRIα, Tryptase
Dendritic cellsPositiveCD11c, MHC-II, CD103
MacrophagesPositiveF4/80, CD68, CD11b
Th2 cellsNegativeGATA3, IL-4, IL-13
NK cellsPositiveNK1.1, CD49b

What approaches would best translate human MS4A15 cancer biomarker findings to mouse models?

To evaluate Ms4a15 as a potential biomarker in mouse models, mirroring human findings:

  • Retrospective analysis methodology:

    • Collect tumor samples from established mouse lung adenocarcinoma models

    • Quantify Ms4a15 expression by RT-qPCR and IHC

    • Correlate with progression and outcome data

    • Perform survival analysis similar to human studies where low MS4A15 expression correlated with worse outcomes

  • Prospective study design:

    • Establish cohorts of mice with various levels of Ms4a15 expression

    • Track tumor development, progression, and response to therapy

    • Calculate hazard ratios for survival based on Ms4a15 expression levels

    • Apply ROC curve analysis to determine sensitivity and specificity

  • Multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify correlated biomarkers that may enhance predictive value

    • Develop integrated biomarker signatures

  • Validation in patient-derived xenograft (PDX) models:

    • Establish PDX models from human LUAD samples

    • Correlate human MS4A15 expression with mouse tumor characteristics

    • Test conservation of prognostic value across species

How can CRISPR-Cas9 be used to study Ms4a15 function in mouse models?

CRISPR-Cas9 offers powerful approaches to investigate Ms4a15 function:

  • In vitro cell line modifications:

    • Design sgRNAs targeting different exons of mouse Ms4a15

    • Create knockout and knockin cell lines

    • Validate edits by sequencing and expression analysis

    • Perform functional assays (proliferation, migration, invasion)

  • In vivo gene editing:

    • Generate conditional knockout mouse models using Cre-loxP systems

    • Create tissue-specific Ms4a15 knockout models

    • Apply AAV-delivered CRISPR systems for spatiotemporal control

    • Design reporter knockins to track Ms4a15 expression in real-time

  • High-throughput screening:

    • Perform CRISPR screens to identify genes interacting with Ms4a15

    • Use CRISPRa/CRISPRi for gain and loss of function studies

    • Combine with single-cell sequencing for heterogeneity analysis

  • Precise point mutations:

    • Introduce mutations corresponding to human variants

    • Generate phosphomimetic/phosphodeficient mutations at key residues

    • Create domain-specific mutations to dissect protein function

What are the optimal conditions for recombinant Ms4a15 protein purification?

As a transmembrane protein, Ms4a15 requires specialized approaches:

  • Membrane protein extraction:

    • Test different detergents (DDM, CHAPS, digitonin) for solubilization

    • Optimize detergent concentration, temperature, and incubation time

    • Consider membrane fractionation before solubilization

  • Purification strategy:

    • Use affinity chromatography with appropriate tags (His, FLAG, Strep)

    • Apply size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography for further purification

  • Stability considerations:

    • Add glycerol (10-15%) to prevent aggregation

    • Include reducing agents if necessary (DTT, β-mercaptoethanol)

    • Test various pH conditions (typically pH 7.0-8.0)

    • Determine optimal salt concentration (typically 150-300 mM NaCl)

  • Quality control methods:

    • SDS-PAGE with Coomassie staining and western blotting

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography with multi-angle light scattering

    • Mass spectrometry for identity confirmation

What experimental controls should be included when studying Ms4a15 in mice?

Robust controls are essential for reliable Ms4a15 research:

  • Genetic controls:

    • Use littermate controls whenever possible

    • Include Ms4a15 knockout mice as negative controls

    • Include Ms4a15 overexpression models as positive controls

    • Consider knockouts of related MS4A family members to test specificity

  • Experimental controls:

    • Include isotype controls for antibody-based detection

    • Use scrambled/non-targeting controls for siRNA/shRNA experiments

    • Include mock-transfected cells for overexpression studies

    • Apply empty vector controls for viral transduction

  • Tissue-specific considerations:

    • Include multiple tissue types to control for tissue-specific effects

    • Compare normal vs. diseased tissue within the same animal

    • Consider age-matched controls to account for age-related changes

  • Technical validation:

    • Validate findings using multiple methodologies (protein, mRNA)

    • Repeat experiments with different detection methods

    • Include positive controls with known expression patterns

How do I analyze Ms4a15 expression data from mouse RNA-sequencing experiments?

For rigorous RNA-seq data analysis:

  • Preprocessing workflow:

    • Quality control assessment using FastQC

    • Adapter trimming and quality filtering

    • Alignment to mouse genome using STAR or HISAT2

    • Quantification with featureCounts or Salmon

  • Differential expression analysis:

    • Use DESeq2 package similar to human MS4A15 studies

    • Apply appropriate statistical thresholds (adjusted p-value <0.05)

    • Visualize using volcano plots and heatmaps

    • Validate key findings with RT-qPCR

  • Pathway analysis:

    • Perform Gene Ontology and KEGG pathway analysis using ClusterProfiler

    • Conduct gene set enrichment analysis (GSEA)

    • Compare with human MS4A15 pathway associations

  • Correlation analysis:

    • Calculate Spearman correlations between Ms4a15 and other genes

    • Perform immune cell infiltration analysis using methods like GSVA

    • Generate correlation heatmaps and network visualizations

What are the best practices for immunohistochemical detection of Ms4a15 in mouse tissues?

For optimal IHC detection of Ms4a15:

  • Tissue preparation:

    • Fix tissues in 10% neutral buffered formalin for 24-48 hours

    • Process and embed in paraffin or use fresh-frozen sections

    • Cut sections at 4-5 μm thickness

    • Include positive control tissues with known Ms4a15 expression

  • Antigen retrieval optimization:

    • Test both heat-induced (citrate, EDTA buffers) and enzymatic methods

    • Optimize pH (6.0-9.0) and retrieval duration

    • Compare microwave, pressure cooker, and water bath heating methods

  • Antibody validation and optimization:

    • Test antibody specificity on Ms4a15 knockout tissues

    • Determine optimal antibody dilution through titration

    • Optimize incubation time and temperature

    • Consider signal amplification systems for low-abundance detection

  • Quantification methods:

    • Establish scoring system (H-score, Allred score)

    • Use digital image analysis software for objective quantification

    • Apply machine learning algorithms for pattern recognition

    • Validate scoring between multiple observers (calculate interobserver agreement)

How can findings from mouse Ms4a15 research be translated to human studies?

To maximize translational relevance:

  • Comparative expression analysis:

    • Compare expression patterns of Ms4a15 in mouse and MS4A15 in human tissues

    • Analyze correlation with disease progression across species

    • Determine if prognostic associations observed in humans (where low MS4A15 correlates with poor survival) are preserved in mouse models

  • Functional conservation assessment:

    • Compare protein interactions and signaling pathways

    • Test if manipulation of Ms4a15 in mice produces outcomes parallel to human MS4A15

    • Validate biomarker potential in both species

  • Cross-species validation pipeline:

    • Develop parallel assays applicable to both mouse and human samples

    • Create humanized mouse models expressing human MS4A15

    • Test therapeutic approaches targeting MS4A15 in mouse models before human trials

  • Translational data integration:

    • Establish databases connecting mouse phenotypes with human disease correlates

    • Develop algorithms to predict human outcomes based on mouse data

    • Apply systems biology approaches to identify conserved regulatory networks

What comparative methods best identify functional similarities between mouse Ms4a15 and human MS4A15?

To establish functional homology:

  • Structural comparison approaches:

    • Perform sequence alignment and homology modeling

    • Identify conserved domains and critical residues

    • Use crystallography or cryo-EM if feasible

    • Apply molecular dynamics simulations to compare protein behavior

  • Functional complementation studies:

    • Express human MS4A15 in Ms4a15-knockout mice

    • Test if human protein rescues mouse phenotypes

    • Analyze domain-swapping between human and mouse proteins

  • Molecular interaction mapping:

    • Perform protein-protein interaction studies (co-IP, Y2H, BioID)

    • Compare interactomes between species

    • Identify conserved binding partners and signaling networks

  • Transcriptional response comparison:

    • Analyze gene expression changes following Ms4a15/MS4A15 modulation

    • Identify conserved transcriptional programs

    • Compare epigenetic regulation between species

How might Ms4a15 research in mice contribute to therapeutic development for human cancers?

Building on human MS4A15's potential as a prognostic marker in LUAD :

  • Target validation approach:

    • Generate mouse models with varying Ms4a15 expression

    • Assess tumor development, progression, and therapy response

    • Determine if modulating Ms4a15 affects cancer outcomes

    • Evaluate potential for MS4A15-directed therapies based on mouse findings

  • Biomarker development pathway:

    • Develop assays to detect Ms4a15/MS4A15 in liquid biopsies

    • Test if Ms4a15 expression predicts therapy response in mouse models

    • Create companion diagnostic approaches that translate from mouse to human

  • Therapeutic strategies:

    • Test antibody-drug conjugates targeting Ms4a15 in mice

    • Develop small molecules that modulate Ms4a15 function

    • Investigate genetic approaches (mRNA, siRNA) for expression modulation

    • Evaluate combination approaches with immunotherapy given MS4A15's correlation with immune cell infiltration

  • Predictive value assessment:

    • Determine if Ms4a15 expression in mice predicts response to specific therapies

    • Compare with human data to validate cross-species predictive power

    • Develop algorithms incorporating Ms4a15/MS4A15 status for treatment selection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.