Recombinant Mouse Membrane-spanning 4-domains subfamily A member 3 (Ms4a3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are open to fulfilling requests for specific tag types. Please inform us of your desired tag, and we will prioritize developing it accordingly.
Synonyms
Ms4a3; Htm4; Membrane-spanning 4-domains subfamily A member 3; Hematopoietic-specific transmembrane protein 4; HTm4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ms4a3
Target Protein Sequence
MKPEETGGSVYQPLDESRHVQRGVLQALGAIQILNGILILALGIFLVCLQHVSHHFRHFF FFTFYTGYPLWGAVFFISSGSLTVAAGRNPTRMLMQNSFGINIASTTIAFVGTVFLSVHL AFNTQAFKGCQSSPSPDVCISLGSSSDGLVSLMLILTLLELSVTISISAMWCLGNVCGLR EAITSPPNSVESGILPEGSDSENLNTQPQASEE
Uniprot No.

Target Background

Function
This protein functions as a hematopoietic modulator during the G1-S cell cycle transition. It regulates the phosphorylation level of cyclin-dependent kinase 2 (CDK2) by directly binding to cyclin-dependent kinase inhibitor 3 (CDKN3/KAP).
Gene References Into Functions
  1. These findings indicate that cell surface expression of MS4A3 effectively distinguishes granulocyte/macrophage lineage-committed progenitors from other lineage-related cells in early human hematopoiesis. In conclusion, MS4A3 serves as a valuable marker for monitoring the early stages of myeloid differentiation in human hematopoiesis. PMID: 29274779
  2. Murine HTm4, primarily a hematopoietic protein, exhibits high expression in the developing and adult murine nervous system. PMID: 15704002
Database Links
Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at low levels only in specific immune tissues, such as, spleen, bone marrow and peripheral blood leukocytes.

Q&A

What is Ms4a3 and where is it primarily expressed in the hematopoietic system?

Ms4a3 is a membrane-associated protein belonging to the Ms4a family, which consists of proteins with four transmembrane domains. It shows highly specific expression in bone marrow granulocyte-monocyte progenitors (GMPs) and committed monocyte progenitor cells (cMoPs). Detailed expression analysis has revealed that Ms4a3 mRNA is restricted to differentiating GMPs and their immediate progeny in the bone marrow, including developing neutrophils and monocytes, as well as basophils and eosinophils. Importantly, Ms4a3 is not expressed in mature resident tissue macrophages (RTMs), dendritic cells (DCs), or lymphoid lineages, making it an excellent marker for specific fate-mapping studies of monocyte-derived cells .

How does Ms4a3 expression change during myeloid cell differentiation?

Ms4a3 shows a dynamic expression pattern during myeloid cell differentiation. Single-cell RNA sequencing and qRT-PCR data demonstrate that Ms4a3 expression begins at the GMP stage, reaches high levels in cMoPs, but is quickly downregulated in mature blood monocytes. In contrast, Ms4a3 expression is maintained in neutrophils and basophils even after they exit the bone marrow. This expression pattern suggests a stage-specific role in myeloid development and makes Ms4a3 particularly valuable for tracing the monocyte lineage specifically .

The table below summarizes Ms4a3 expression across different cell populations:

Cell TypeMs4a3 Expression Level
GMPsHigh
cMoPsHigh
BM MonocytesModerate
Blood MonocytesLow/None
NeutrophilsHigh
BasophilsHigh
EosinophilsLow
DCs (all subsets)None
RTMs (all tissues)None
Lymphoid cellsNone

What advantages does Ms4a3-based fate mapping offer over other monocyte lineage tracing models?

Ms4a3-based fate mapping provides several distinct advantages over previous models based on Cx3cr1 or Lyz2. Single-cell RNA sequencing analyses have revealed that unlike Ms4a3 (which is specific to monocyte progenitors), Lyz2 is expressed at higher levels in terminally differentiated Ly6C^hi monocytes than in cMoPs and is also expressed by pre-DCs. Similarly, Cx3cr1 is expressed by both monocyte-primed cells and DC-primed cells, limiting its specificity for monocyte lineage tracing .

The Cre-Rosa TdT Ms4a3 model traces blood monocytes with remarkable efficiency (97%) and granulocytes (100%), while leaving lymphocytes and tissue dendritic cells unlabeled. This high specificity allows researchers to unambiguously identify monocyte-derived cells in tissues and quantify their contribution to resident macrophage populations with unprecedented precision .

How can researchers differentiate between Ms4a3-labeled granulocytes and monocytes in experimental settings?

While the Ms4a3 fate-mapping model labels both granulocytes and monocytes, these populations can be readily distinguished by using additional markers. Granulocytes (particularly neutrophils) can be identified with specific markers such as Ly6G. In flow cytometry applications, researchers should design panels that include:

  • The reporter fluorochrome (e.g., tdTomato) to identify Ms4a3-traced cells

  • Ly6G to identify granulocytes

  • Monocyte markers (CD115, Ly6C) to distinguish monocyte populations

  • Additional lineage markers as needed for specific tissue contexts

This approach allows for clear discrimination between granulocytes and monocytes, both of which are labeled in the Ms4a3 fate-mapping model but can be easily separated based on their distinct marker profiles .

What are the optimal protocols for generating and validating Ms4a3 reporter mice?

Based on available research, the development of Ms4a3 reporter mice involves inserting an Ires-tdTomato sequence downstream of the Ms4a3 stop codon. For Cre-based fate mapping, the insertion of Cre recombinase at this locus allows for permanent labeling of cells that have expressed Ms4a3 during their development .

Key validation steps should include:

  • Detailed flow cytometric analysis of bone marrow progenitors (GMPs, cMoPs) to confirm reporter expression

  • Verification of reporter expression in mature myeloid populations (neutrophils, monocytes, basophils)

  • Confirmation of lack of expression in lymphoid lineages, dendritic cells, and tissue-resident macrophages

  • Functional validation through in vitro differentiation assays and in vivo transplantation experiments

The generation of both reporter models (Ms4a3 TdT) and fate-mapping models (Cre-Rosa TdT) allows researchers to distinguish between current Ms4a3 expression and historical expression, providing complementary information about cell lineage relationships .

What controls should be included when designing experiments using Ms4a3-based fate mapping?

When using Ms4a3-based fate mapping, researchers should include several critical controls:

  • Age-matched wild-type controls: To account for autofluorescence, particularly in tissues with high background (liver, lung)

  • Reporter-only controls: Animals with the fluorescent reporter but without Cre recombinase

  • Positive control tissues: Samples with known high proportions of monocyte-derived cells

  • Time-course analysis: Examination of labeled cell frequencies at multiple time points to assess kinetics

  • Inflammatory challenge controls: Comparison of steady-state vs. inflammatory conditions to demonstrate dynamic range of the system

Additionally, researchers should consider parallel experiments with alternative fate-mapping systems (e.g., Cx3cr1-based) to compare results and identify potential biases specific to each system .

How does Ms4a3 contribute to cell cycle regulation in hematopoietic cells?

Ms4a3 plays a significant role in cell cycle regulation within hematopoietic cells. Functional studies have demonstrated that MS4A3 (the human ortholog sharing 62% amino acid identity with mouse Ms4a3) interacts with cyclin-dependent kinase (CDK)–associated phosphatase (KAP)-CDK2 complexes. This interaction enhances KAP phosphatase activity, which in turn deactivates CDK2 .

The regulation of CDK2 is crucial for cell cycle progression, particularly at the G1/S phase transition. Studies have shown that MS4A3 overexpression promotes CDK2 dephosphorylation and leads to cell cycle arrest at the G0/G1 phase in human myeloid cell lines. This suggests that Ms4a3 may function as a "proliferative brake" in actively dividing myeloid progenitors .

The tight regulation of Ms4a3 expression during myeloid differentiation may therefore reflect its importance in controlling proliferation and differentiation timing. Future studies using conditional knockout models and targeted overexpression will further elucidate the specific mechanisms through which Ms4a3 regulates cell cycle in different hematopoietic populations .

What is the relationship between mouse Ms4a3 and human MS4A3, and what are the implications for translational research?

Expression patterns of MS4A3 in human bone marrow and peripheral blood cells mirror those observed in mice. In human bone marrow, MS4A3 expression increases with progressive myeloid differentiation, while lymphoid or megakaryocytic-erythrocytic progenitors lack MS4A3 expression. In peripheral blood, human MS4A3 is highly expressed in basophils, similar to the mouse pattern .

This conservation of both sequence and expression pattern suggests that findings from mouse Ms4a3 studies may have translational relevance to human biology. Researchers should consider:

  • The potential for MS4A3 as a biomarker for specific myeloid populations in human samples

  • Possible involvement of MS4A3 dysregulation in human myeloid disorders

  • The utility of targeting MS4A3 pathways in therapeutic development for conditions involving aberrant myeloid cell development or function

Given the similar expression profiles and functional conservation, mouse Ms4a3 research can inform human studies while recognizing potential species-specific differences in regulatory mechanisms .

How should researchers quantify monocyte contribution to tissue macrophage populations using Ms4a3 fate mapping?

The quantification of monocyte contribution to tissue macrophage populations using Ms4a3 fate mapping requires rigorous analytical approaches. Researchers should:

  • Define clear gating strategies: Establish consistent flow cytometry gating that distinguishes resident macrophages from other myeloid populations based on established markers (F4/80, CD64, tissue-specific markers)

  • Calculate labeling percentages: Determine the percentage of macrophages expressing the Ms4a3-driven reporter relative to the total macrophage pool

  • Track kinetics: Monitor changes in labeling percentages over time to assess replacement rates

  • Control for inflammation: Compare steady-state labeling with that observed during inflammatory challenges

  • Consider sex differences: Analyze data from male and female mice separately, as monocyte contribution may vary by sex

  • Account for age effects: Age-stratify analyses, as monocyte contribution to some RTM populations increases with age

The precise quantification enabled by the Ms4a3 fate-mapping system allows researchers to resolve longstanding questions about the relative contribution of embryonic precursors versus blood monocytes to tissue macrophage pools under various conditions .

What are potential caveats or limitations when interpreting Ms4a3 fate mapping results?

While Ms4a3 fate mapping offers significant advantages, researchers should be aware of several potential limitations:

  • Labeling efficiency: Although the system labels 97% of monocytes, the small unlabeled fraction could lead to slight underestimation of monocyte contribution

  • Granulocyte contamination: Since granulocytes are also labeled, meticulous analysis is required to distinguish them from monocyte-derived cells

  • Developmental timing: The system only tracks cells that have expressed Ms4a3 after the establishment of the fate-mapping model, potentially missing early developmental contributions

  • Heterogeneity within progenitors: Not all GMPs may express Ms4a3 at equal levels, potentially introducing bias in which progenitor subsets are tracked

  • Potential leakiness: As with any genetic system, researchers should verify the absence of unexpected reporter expression

To address these limitations, researchers should consider complementary approaches, including parabiosis, adoptive transfer experiments, or alternative fate-mapping systems to corroborate findings obtained with the Ms4a3 system .

What are promising future applications of Ms4a3-based research tools?

Ms4a3-based research tools open several exciting avenues for future investigation:

  • Single-cell fate mapping: Combining Ms4a3 fate mapping with single-cell RNA sequencing to delineate the heterogeneity within monocyte-derived populations

  • Functional genomics: Using Ms4a3-Cre for conditional deletion of genes specifically in the monocyte lineage

  • Disease modeling: Leveraging Ms4a3 tools to track monocyte contributions to pathological processes in models of inflammatory, autoimmune, and neurodegenerative diseases

  • Therapeutic targeting: Exploring Ms4a3-expressing progenitors as potential targets for intervention in disorders of myeloid cell production or function

  • Developmental immunology: Refining our understanding of the ontogeny of tissue macrophage populations during embryonic development and postnatal life

The specificity of the Ms4a3 system makes it particularly valuable for these applications, enabling precise manipulation and tracking of monocyte lineages without affecting other hematopoietic populations .

How might Ms4a3 knockout or overexpression models enhance our understanding of myeloid cell biology?

The development of Ms4a3 knockout or conditional knockout models would provide valuable insights into the functional role of this protein in myeloid development and function. These models could help address several key questions:

  • Is Ms4a3 required for normal GMP development and differentiation?

  • How does the absence of Ms4a3 affect cell cycle regulation in myeloid progenitors?

  • Are there consequences of Ms4a3 deficiency for mature monocyte and granulocyte function?

  • Could Ms4a3 manipulation alter the balance between different myeloid lineages?

Conversely, overexpression models could reveal:

  • Whether increased Ms4a3 expression blocks proliferation of myeloid progenitors

  • If constitutive Ms4a3 expression in mature cells affects their function or lifespan

  • Whether Ms4a3 overexpression might have therapeutic applications in conditions characterized by excessive myeloid cell production

These genetic approaches would complement the existing fate-mapping tools and provide a more comprehensive understanding of Ms4a3 biology in the myeloid compartment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.